CALML5 (calmodulin like 5)

Gene

• Entrez ID: 51806
• Gene name: Calmodulin like 5
• Gene symbol: CALML5
• Synonyms (NCBI Gene): CLSP
• Chromosome: 10
• Chromosome location: 10p15.1
• Summary: This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins. Functional studies with recombinant protein demonstrate it does bind calcium and undergoes a conformational chan

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018952	hsa-miR-335-5p	Microarray	18185580
MIRT021412	hsa-miR-9-5p	Microarray	17612493
MIRT859594	hsa-miR-24	CLIP-seq
MIRT859595	hsa-miR-4716-3p	CLIP-seq
MIRT859594	hsa-miR-24	CLIP-seq
MIRT2192843	hsa-miR-15a	CLIP-seq
MIRT2192844	hsa-miR-15b	CLIP-seq
MIRT2192845	hsa-miR-16	CLIP-seq
MIRT2192846	hsa-miR-195	CLIP-seq
MIRT2192847	hsa-miR-424	CLIP-seq
MIRT2192848	hsa-miR-4767	CLIP-seq
MIRT2192849	hsa-miR-497	CLIP-seq
MIRT2192850	hsa-miR-503	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	10777582
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	TAS	10777582
GO:0008544	Process	Epidermis development	TAS	10777582
GO:0030234	Function	Enzyme regulator activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 605183
• HGNC: 18180
• e!Ensembl: ENSG00000178372

Protein

• UniProt ID: Q9NZT1
• Protein name: Calmodulin-like protein 5 (Calmodulin-like skin protein)
• Protein function: Binds calcium. May be involved in terminal differentiation of keratinocytes.
• PDB: 2B1U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	10 → 74	EF-hand domain pair	Domain
  PF00036	EF-hand_1	12 → 40	EF hand	Domain
  PF13499	EF-hand_7	80 → 144	EF-hand domain pair	Domain
  PF13833	EF-hand_8	95 → 146	EF-hand domain pair	Domain

• Tissue specificity: TISSUE SPECIFICITY: Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.
• Sequence:

  MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
  DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD
  AMIREADVDQDGRVNYEEFARMLAQE

• Sequence length: 146