Gene Gene information from NCBI Gene database.
Entrez ID 59283
Gene name Calcium voltage-gated channel auxiliary subunit gamma 8
Gene symbol CACNG8
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.42
Summary The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the
miRNA miRNA information provided by mirtarbase database.
1757
miRTarBase ID miRNA Experiments Reference
MIRT019066 hsa-miR-335-5p Microarray 18185580
MIRT052055 hsa-let-7b-5p CLASH 23622248
MIRT051755 hsa-let-7c-5p CLASH 23622248
MIRT051710 hsa-let-7d-5p CLASH 23622248
MIRT039482 hsa-miR-652-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0005245 Function Voltage-gated calcium channel activity IBA
GO:0005245 Function Voltage-gated calcium channel activity NAS 11170751
GO:0005246 Function Calcium channel regulator activity ISS
GO:0005262 Function Calcium channel activity IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606900 13628 ENSG00000142408
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXS5
Protein name Voltage-dependent calcium channel gamma-8 subunit (Neuronal voltage-gated calcium channel gamma-8 subunit) (Transmembrane AMPAR regulatory protein gamma-8) (TARP gamma-8)
Protein function Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (By similarity). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00822 PMP22_Claudin 17 223 PMP-22/EMP/MP20/Claudin family Family
Tissue specificity TISSUE SPECIFICITY: Detected in heart left ventricle. {ECO:0000269|PubMed:21127204}.
Sequence
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLA
VNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR
KTTPV
Sequence length 425
Interactions View interactions