Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	59284
Gene name	Calcium voltage-gated channel auxiliary subunit gamma 7
Gene symbol	CACNG7
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.42
Summary	The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of th

115

Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT508852	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT508851	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT508850	hsa-miR-1272	PAR-CLIP	20371350
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508848	hsa-miR-3161	PAR-CLIP	20371350
MIRT508847	hsa-miR-599	PAR-CLIP	20371350
MIRT508852	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT508851	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT508850	hsa-miR-1272	PAR-CLIP	20371350
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508848	hsa-miR-3161	PAR-CLIP	20371350
MIRT508847	hsa-miR-599	PAR-CLIP	20371350
MIRT560196	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT560195	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT560194	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT560193	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560192	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT560191	hsa-miR-765	PAR-CLIP	20371350
MIRT508852	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT508851	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT508850	hsa-miR-1272	PAR-CLIP	22012620
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT508848	hsa-miR-3161	PAR-CLIP	22012620
MIRT508847	hsa-miR-599	PAR-CLIP	22012620
MIRT508852	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT508851	hsa-miR-580-5p	PAR-CLIP	23446348
MIRT508850	hsa-miR-1272	PAR-CLIP	23446348
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT508848	hsa-miR-3161	PAR-CLIP	23446348
MIRT508847	hsa-miR-599	PAR-CLIP	23446348
MIRT508852	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT508851	hsa-miR-580-5p	PAR-CLIP	23446348
MIRT508850	hsa-miR-1272	PAR-CLIP	23446348
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT508848	hsa-miR-3161	PAR-CLIP	23446348
MIRT508847	hsa-miR-599	PAR-CLIP	23446348
MIRT508852	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT508851	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT508850	hsa-miR-1272	PAR-CLIP	20371350
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508848	hsa-miR-3161	PAR-CLIP	20371350
MIRT508847	hsa-miR-599	PAR-CLIP	20371350
MIRT508852	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT508851	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT508850	hsa-miR-1272	PAR-CLIP	20371350
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508848	hsa-miR-3161	PAR-CLIP	20371350
MIRT508847	hsa-miR-599	PAR-CLIP	20371350
MIRT560196	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT560195	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT560194	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT560193	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560192	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT560191	hsa-miR-765	PAR-CLIP	20371350
MIRT508852	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT508851	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT508850	hsa-miR-1272	PAR-CLIP	22012620
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT508848	hsa-miR-3161	PAR-CLIP	22012620
MIRT508847	hsa-miR-599	PAR-CLIP	22012620
MIRT508852	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT508851	hsa-miR-580-5p	PAR-CLIP	23446348
MIRT508850	hsa-miR-1272	PAR-CLIP	23446348
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT508848	hsa-miR-3161	PAR-CLIP	23446348
MIRT508847	hsa-miR-599	PAR-CLIP	23446348
MIRT508852	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT508851	hsa-miR-580-5p	PAR-CLIP	23446348
MIRT508850	hsa-miR-1272	PAR-CLIP	23446348
MIRT508849	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT508848	hsa-miR-3161	PAR-CLIP	23446348
MIRT508847	hsa-miR-599	PAR-CLIP	23446348
MIRT858222	hsa-miR-1276	CLIP-seq
MIRT858223	hsa-miR-1913	CLIP-seq
MIRT858224	hsa-miR-3125	CLIP-seq
MIRT858225	hsa-miR-3184	CLIP-seq
MIRT858226	hsa-miR-324-3p	CLIP-seq
MIRT858227	hsa-miR-331-3p	CLIP-seq
MIRT858228	hsa-miR-3714	CLIP-seq
MIRT858229	hsa-miR-3916	CLIP-seq
MIRT858230	hsa-miR-3943	CLIP-seq
MIRT858231	hsa-miR-423-5p	CLIP-seq
MIRT858232	hsa-miR-4313	CLIP-seq
MIRT858233	hsa-miR-4532	CLIP-seq
MIRT858234	hsa-miR-4640-5p	CLIP-seq
MIRT858235	hsa-miR-4726-5p	CLIP-seq
MIRT858236	hsa-miR-4736	CLIP-seq
MIRT858237	hsa-miR-4779	CLIP-seq
MIRT858238	hsa-miR-548an	CLIP-seq
MIRT858239	hsa-miR-7	CLIP-seq
MIRT858240	hsa-miR-940	CLIP-seq
MIRT1954868	hsa-miR-3175	CLIP-seq
MIRT858228	hsa-miR-3714	CLIP-seq
MIRT858230	hsa-miR-3943	CLIP-seq
MIRT1954869	hsa-miR-4300	CLIP-seq
MIRT858232	hsa-miR-4313	CLIP-seq
MIRT858236	hsa-miR-4736	CLIP-seq
MIRT858238	hsa-miR-548an	CLIP-seq
MIRT1954870	hsa-miR-920	CLIP-seq
MIRT858240	hsa-miR-940	CLIP-seq
MIRT2192440	hsa-miR-214	CLIP-seq
MIRT2192441	hsa-miR-3619-5p	CLIP-seq
MIRT858228	hsa-miR-3714	CLIP-seq
MIRT858230	hsa-miR-3943	CLIP-seq
MIRT858232	hsa-miR-4313	CLIP-seq
MIRT2192442	hsa-miR-4530	CLIP-seq
MIRT858236	hsa-miR-4736	CLIP-seq
MIRT858238	hsa-miR-548an	CLIP-seq
MIRT2192443	hsa-miR-761	CLIP-seq
MIRT858240	hsa-miR-940	CLIP-seq
MIRT2436037	hsa-miR-3621	CLIP-seq
MIRT2436038	hsa-miR-3656	CLIP-seq
MIRT2677209	hsa-miR-142-5p	CLIP-seq
MIRT2677210	hsa-miR-203	CLIP-seq
MIRT2677211	hsa-miR-561	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA
GO:0005245	Function	Voltage-gated calcium channel activity	NAS	11170751
GO:0005246	Function	Calcium channel regulator activity	IDA	21127204
GO:0005262	Function	Calcium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	NAS	11170751
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	NAS	11170751
GO:0016020	Component	Membrane	IEA
GO:0016247	Function	Channel regulator activity	IBA
GO:0019226	Process	Transmission of nerve impulse	IBA
GO:0032281	Component	AMPA glutamate receptor complex	IBA
GO:0032281	Component	AMPA glutamate receptor complex	IEA
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0044300	Component	Cerebellar mossy fiber	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:1903861	Process	Positive regulation of dendrite extension	IEA
GO:1990454	Component	L-type voltage-gated calcium channel complex	IDA	21127204
GO:2000311	Process	Regulation of AMPA receptor activity	IDA	21172611

MIM	HGNC	e!Ensembl
606899	13626	ENSG00000105605

P62955

Protein name

Voltage-dependent calcium channel gamma-7 subunit (Neuronal voltage-gated calcium channel gamma-7 subunit) (Transmembrane AMPAR regulatory protein gamma-7) (TARP gamma-7)

Protein function

Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (PubMed:21127204). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cel

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13903	Claudin_2	18 → 197	PMP-22/EMP/MP20/Claudin tight junction	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in heart left ventricle (PubMed:21127204). Widely expressed. {ECO:0000269|PubMed:11170751, ECO:0000269|PubMed:21127204}.

Sequence

MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC

Sequence length

275

Interactions

View interactions

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability	Likely pathogenic	rs778171763	RCV001291077

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Renal Cell	Associate	23428843
Cardiomyopathies	Inhibit	20090424
Intellectual Disability	Associate	30167849

CACNG7 (calcium voltage-gated channel auxiliary subunit gamma 7)