Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27091
Gene name Gene Name - the full gene name approved by the HGNC.	Calcium voltage-gated channel auxiliary subunit gamma 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CACNG5
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of th

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025910	hsa-miR-7-5p	Microarray	17612493

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0014069	Component	Postsynaptic density	ISS
GO:0015075	Function	Ion transmembrane transporter activity	TAS	10613843
GO:0016247	Function	Channel regulator activity	IBA	21873635
GO:0019226	Process	Transmission of nerve impulse	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA	21873635
GO:0098943	Process	Neurotransmitter receptor transport, postsynaptic endosome to lysosome	IBA	21873635
GO:0098962	Process	Regulation of postsynaptic neurotransmitter receptor activity	IMP	18817736
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IMP	18817736
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	ISS

MIM	HGNC	e!Ensembl
606405	1409	ENSG00000075429

Protein

UniProt ID

Q9UF02

Protein name

Voltage-dependent calcium channel gamma-5 subunit (Neuronal voltage-gated calcium channel gamma-5 subunit) (Transmembrane AMPAR regulatory protein gamma-5) (TARP gamma-5)

Protein function

Regulates the gating properties of AMPA-selective glutamate receptors (AMPARs). Modulates their gating properties by accelerating their rates of activation, deactivation and desensitization. Displays subunit-specific AMPA receptor regulation. Sh

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	7 → 196	PMP-22/EMP/MP20/Claudin family	Family

Sequence

MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

Sequence length

275

Interactions

View interactions

CACNG5 (calcium voltage-gated channel auxiliary subunit gamma 5)