CACNG3 (calcium voltage-gated channel auxiliary subunit gamma 3)

Gene

• Entrez ID: 10368
• Gene name: Calcium voltage-gated channel auxiliary subunit gamma 3
• Gene symbol: CACNG3
• Synonyms (NCBI Gene): -
• Chromosome: 16
• Chromosome location: 16p12.1
• Summary: The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029027	hsa-miR-26b-5p	Microarray	19088304
MIRT858069	hsa-miR-299-3p	CLIP-seq
MIRT858070	hsa-miR-3117-3p	CLIP-seq
MIRT858071	hsa-miR-3169	CLIP-seq
MIRT858072	hsa-miR-3184	CLIP-seq
MIRT858073	hsa-miR-423-5p	CLIP-seq
MIRT858074	hsa-miR-432	CLIP-seq
MIRT858075	hsa-miR-4443	CLIP-seq
MIRT858076	hsa-miR-4446-3p	CLIP-seq
MIRT858077	hsa-miR-4648	CLIP-seq
MIRT858078	hsa-miR-4654	CLIP-seq
MIRT858079	hsa-miR-4656	CLIP-seq
MIRT858080	hsa-miR-4668-5p	CLIP-seq
MIRT858081	hsa-miR-4710	CLIP-seq
MIRT858082	hsa-miR-4721	CLIP-seq
MIRT858083	hsa-miR-4759	CLIP-seq
MIRT858084	hsa-miR-4769-5p	CLIP-seq
MIRT858085	hsa-miR-890	CLIP-seq
MIRT858082	hsa-miR-4721	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IBA	21873635
GO:0005245	Function	Voltage-gated calcium channel activity	NAS	10221464
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	NAS	10221464
GO:0006605	Process	Protein targeting	ISS
GO:0006816	Process	Calcium ion transport	NAS	10221464
GO:0008104	Process	Protein localization	ISS
GO:0016247	Function	Channel regulator activity	IBA	21873635
GO:0019226	Process	Transmission of nerve impulse	IBA	21873635
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0032281	Component	AMPA glutamate receptor complex	IBA	21873635
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0036477	Component	Somatodendritic compartment	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0060076	Component	Excitatory synapse	IEA
GO:0061337	Process	Cardiac conduction	TAS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA	21873635
GO:0098943	Process	Neurotransmitter receptor transport, postsynaptic endosome to lysosome	IBA	21873635
GO:0098970	Process	Postsynaptic neurotransmitter receptor diffusion trapping	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099590	Process	Neurotransmitter receptor internalization	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	IBA	21873635
GO:2000311	Process	Regulation of AMPA receptor activity	ISS
GO:2000969	Process	Positive regulation of AMPA receptor activity	IEA

Other IDs

• MIM: 606403
• HGNC: 1407
• e!Ensembl: ENSG00000006116

Protein

• UniProt ID: O60359
• Protein name: Voltage-dependent calcium channel gamma-3 subunit (Neuronal voltage-gated calcium channel gamma-3 subunit) (Transmembrane AMPAR regulatory protein gamma-3) (TARP gamma-3)
• Protein function: Regulates the trafficking to the somatodendritic compartment and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	6 → 196	PMP-22/EMP/MP20/Claudin family	Family

• Sequence:

  MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
  SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
  CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
  FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
  EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
  ESLHNNPANRRTTPV

• Sequence length: 315

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Metabolic Syndrome	Metabolic Syndrome			GWAS
Oligodendroglioma	Oligodendroglioma			GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.		GWAS, CBGDA

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Pancreatic Ductal	Associate	37794108
Epilepsy Absence	Associate	17264864
Glioma	Inhibit	37697240
Leukemia Promyelocytic Acute	Associate	21169531
Macular Degeneration	Associate	21169531
Neoplasms	Associate	26209800