Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	783
Gene name	Calcium voltage-gated channel auxiliary subunit beta 2
Gene symbol	CACNB2
Synonyms (NCBI Gene)	CAB2CACNLB2CAVB2MYSB
Chromosome	10
Chromosome location	10p12.33-p12.31
Summary	This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmu

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs149253719	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity, benign, likely-benign	Coding sequence variant, missense variant, non coding transcript variant, 5 prime UTR variant
rs150528041	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant, non coding transcript variant, 5 prime UTR variant, genic upstream transcript variant
rs150722502	G>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, non coding transcript variant, genic upstream transcript variant
rs200367454	C>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	5 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant
rs587777742	C>T	Pathogenic	Coding sequence variant, intron variant, genic upstream transcript variant, missense variant
rs755056713	C>A,T	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, genic upstream transcript variant, coding sequence variant, stop gained, missense variant, 5 prime UTR variant

333

Show/Hide all (333)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029034	hsa-miR-26b-5p	Microarray	19088304
MIRT051063	hsa-miR-16-5p	CLASH	23622248
MIRT051063	hsa-miR-16-5p	CLASH	23622248
MIRT716916	hsa-miR-548u	HITS-CLIP	19536157
MIRT716914	hsa-miR-7161-5p	HITS-CLIP	19536157
MIRT716913	hsa-miR-8087	HITS-CLIP	19536157
MIRT716912	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT716910	hsa-miR-4450	HITS-CLIP	19536157
MIRT716911	hsa-miR-2052	HITS-CLIP	19536157
MIRT716909	hsa-miR-19a-5p	HITS-CLIP	19536157
MIRT716908	hsa-miR-19b-1-5p	HITS-CLIP	19536157
MIRT716907	hsa-miR-19b-2-5p	HITS-CLIP	19536157
MIRT716906	hsa-miR-2110	HITS-CLIP	19536157
MIRT716905	hsa-miR-6810-5p	HITS-CLIP	19536157
MIRT716904	hsa-miR-3150a-3p	HITS-CLIP	19536157
MIRT716903	hsa-miR-6763-5p	HITS-CLIP	19536157
MIRT716902	hsa-miR-6857-5p	HITS-CLIP	19536157
MIRT716901	hsa-miR-450a-2-3p	HITS-CLIP	19536157
MIRT716899	hsa-miR-4260	HITS-CLIP	19536157
MIRT716900	hsa-miR-5572	HITS-CLIP	19536157
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628387	hsa-miR-4635	HITS-CLIP	23824327
MIRT628386	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628382	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT628381	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628387	hsa-miR-4635	HITS-CLIP	23824327
MIRT628386	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628382	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT628381	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628387	hsa-miR-4635	HITS-CLIP	23824327
MIRT628386	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628382	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT628381	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT716916	hsa-miR-548u	HITS-CLIP	19536157
MIRT716914	hsa-miR-7161-5p	HITS-CLIP	19536157
MIRT716913	hsa-miR-8087	HITS-CLIP	19536157
MIRT716912	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT716910	hsa-miR-4450	HITS-CLIP	19536157
MIRT716911	hsa-miR-2052	HITS-CLIP	19536157
MIRT716909	hsa-miR-19a-5p	HITS-CLIP	19536157
MIRT716908	hsa-miR-19b-1-5p	HITS-CLIP	19536157
MIRT716907	hsa-miR-19b-2-5p	HITS-CLIP	19536157
MIRT716906	hsa-miR-2110	HITS-CLIP	19536157
MIRT716905	hsa-miR-6810-5p	HITS-CLIP	19536157
MIRT716904	hsa-miR-3150a-3p	HITS-CLIP	19536157
MIRT716903	hsa-miR-6763-5p	HITS-CLIP	19536157
MIRT716902	hsa-miR-6857-5p	HITS-CLIP	19536157
MIRT716901	hsa-miR-450a-2-3p	HITS-CLIP	19536157
MIRT716899	hsa-miR-4260	HITS-CLIP	19536157
MIRT716900	hsa-miR-5572	HITS-CLIP	19536157
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628387	hsa-miR-4635	HITS-CLIP	23824327
MIRT628386	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628382	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT628381	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628387	hsa-miR-4635	HITS-CLIP	23824327
MIRT628386	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628382	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT628381	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT628394	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT628393	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT628392	hsa-miR-764	HITS-CLIP	23824327
MIRT628391	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT628390	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628389	hsa-miR-5193	HITS-CLIP	23824327
MIRT628388	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT628387	hsa-miR-4635	HITS-CLIP	23824327
MIRT628386	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT628385	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT628384	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT628383	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT628382	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT628381	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT628380	hsa-miR-640	HITS-CLIP	23824327
MIRT857865	hsa-miR-1287	CLIP-seq
MIRT857866	hsa-miR-1324	CLIP-seq
MIRT857867	hsa-miR-3135b	CLIP-seq
MIRT857868	hsa-miR-3660	CLIP-seq
MIRT857869	hsa-miR-370	CLIP-seq
MIRT857870	hsa-miR-4256	CLIP-seq
MIRT857871	hsa-miR-4526	CLIP-seq
MIRT857872	hsa-miR-30a	CLIP-seq
MIRT857873	hsa-miR-30b	CLIP-seq
MIRT857874	hsa-miR-30c	CLIP-seq
MIRT857875	hsa-miR-30d	CLIP-seq
MIRT857876	hsa-miR-30e	CLIP-seq
MIRT857877	hsa-miR-550b	CLIP-seq
MIRT857878	hsa-miR-4280	CLIP-seq
MIRT857879	hsa-miR-1297	CLIP-seq
MIRT857880	hsa-miR-1305	CLIP-seq
MIRT857881	hsa-miR-150	CLIP-seq
MIRT857882	hsa-miR-181a	CLIP-seq
MIRT857883	hsa-miR-181b	CLIP-seq
MIRT857884	hsa-miR-181c	CLIP-seq
MIRT857885	hsa-miR-181d	CLIP-seq
MIRT857886	hsa-miR-26a	CLIP-seq
MIRT857887	hsa-miR-26b	CLIP-seq
MIRT857888	hsa-miR-302f	CLIP-seq
MIRT857889	hsa-miR-3143	CLIP-seq
MIRT857890	hsa-miR-4252	CLIP-seq
MIRT857891	hsa-miR-4262	CLIP-seq
MIRT857892	hsa-miR-4438	CLIP-seq
MIRT857893	hsa-miR-4465	CLIP-seq
MIRT857894	hsa-miR-4705	CLIP-seq
MIRT857895	hsa-miR-4731-5p	CLIP-seq
MIRT857896	hsa-miR-498	CLIP-seq
MIRT857897	hsa-miR-5095	CLIP-seq
MIRT857898	hsa-miR-543	CLIP-seq
MIRT1954768	hsa-miR-101	CLIP-seq
MIRT1954769	hsa-miR-1306	CLIP-seq
MIRT1954770	hsa-miR-144	CLIP-seq
MIRT1954771	hsa-miR-3187-3p	CLIP-seq
MIRT1954772	hsa-miR-4435	CLIP-seq
MIRT1954773	hsa-miR-4672	CLIP-seq
MIRT1954774	hsa-miR-4701-5p	CLIP-seq
MIRT1954775	hsa-miR-4755-3p	CLIP-seq
MIRT1954776	hsa-miR-548s	CLIP-seq
MIRT1954777	hsa-miR-588	CLIP-seq
MIRT1954769	hsa-miR-1306	CLIP-seq
MIRT1954771	hsa-miR-3187-3p	CLIP-seq
MIRT2192352	hsa-miR-3545-3p	CLIP-seq
MIRT2192353	hsa-miR-3663-5p	CLIP-seq
MIRT1954772	hsa-miR-4435	CLIP-seq
MIRT1954774	hsa-miR-4701-5p	CLIP-seq
MIRT1954775	hsa-miR-4755-3p	CLIP-seq
MIRT857897	hsa-miR-5095	CLIP-seq
MIRT1954776	hsa-miR-548s	CLIP-seq
MIRT1954777	hsa-miR-588	CLIP-seq
MIRT2495657	hsa-miR-1228	CLIP-seq
MIRT2495658	hsa-miR-1245b-3p	CLIP-seq
MIRT2495659	hsa-miR-1251	CLIP-seq
MIRT2495660	hsa-miR-125a-5p	CLIP-seq
MIRT2495661	hsa-miR-125b	CLIP-seq
MIRT2495662	hsa-miR-1271	CLIP-seq
MIRT2495663	hsa-miR-128	CLIP-seq
MIRT2495664	hsa-miR-137	CLIP-seq
MIRT2495665	hsa-miR-145	CLIP-seq
MIRT2495666	hsa-miR-182	CLIP-seq
MIRT2495667	hsa-miR-1825	CLIP-seq
MIRT2495668	hsa-miR-1827	CLIP-seq
MIRT2495669	hsa-miR-199a-5p	CLIP-seq
MIRT2495670	hsa-miR-199b-5p	CLIP-seq
MIRT2495671	hsa-miR-2053	CLIP-seq
MIRT2495672	hsa-miR-23a	CLIP-seq
MIRT2495673	hsa-miR-23b	CLIP-seq
MIRT2495674	hsa-miR-23c	CLIP-seq
MIRT2495675	hsa-miR-27a	CLIP-seq
MIRT2495676	hsa-miR-27b	CLIP-seq
MIRT2495677	hsa-miR-28-5p	CLIP-seq
MIRT2495678	hsa-miR-3117-5p	CLIP-seq
MIRT2495679	hsa-miR-3120-3p	CLIP-seq
MIRT2495680	hsa-miR-3124-3p	CLIP-seq
MIRT2495681	hsa-miR-3139	CLIP-seq
MIRT2495682	hsa-miR-3160-5p	CLIP-seq
MIRT2495683	hsa-miR-3173-3p	CLIP-seq
MIRT2495684	hsa-miR-3180-5p	CLIP-seq
MIRT2495685	hsa-miR-3193	CLIP-seq
MIRT2192352	hsa-miR-3545-3p	CLIP-seq
MIRT2495686	hsa-miR-3612	CLIP-seq
MIRT2495687	hsa-miR-3685	CLIP-seq
MIRT2495688	hsa-miR-369-3p	CLIP-seq
MIRT2495689	hsa-miR-374c	CLIP-seq
MIRT2495690	hsa-miR-384	CLIP-seq
MIRT2495691	hsa-miR-3934	CLIP-seq
MIRT2495692	hsa-miR-3938	CLIP-seq
MIRT2495693	hsa-miR-3940-5p	CLIP-seq
MIRT2495694	hsa-miR-3942-5p	CLIP-seq
MIRT2495695	hsa-miR-4272	CLIP-seq
MIRT2495696	hsa-miR-4282	CLIP-seq
MIRT2495697	hsa-miR-4302	CLIP-seq
MIRT2495698	hsa-miR-4319	CLIP-seq
MIRT2495699	hsa-miR-4325	CLIP-seq
MIRT2495700	hsa-miR-4422	CLIP-seq
MIRT2495701	hsa-miR-4506	CLIP-seq
MIRT2495702	hsa-miR-4507	CLIP-seq
MIRT2495703	hsa-miR-4639-3p	CLIP-seq
MIRT2495704	hsa-miR-4653-3p	CLIP-seq
MIRT2495705	hsa-miR-4661-5p	CLIP-seq
MIRT2495706	hsa-miR-4695-5p	CLIP-seq
MIRT2495707	hsa-miR-4699-3p	CLIP-seq
MIRT2495708	hsa-miR-4703-5p	CLIP-seq
MIRT2495709	hsa-miR-4704-5p	CLIP-seq
MIRT2495710	hsa-miR-4724-3p	CLIP-seq
MIRT2495711	hsa-miR-4732-3p	CLIP-seq
MIRT2495712	hsa-miR-4735-5p	CLIP-seq
MIRT2495713	hsa-miR-4742-3p	CLIP-seq
MIRT1954775	hsa-miR-4755-3p	CLIP-seq
MIRT2495714	hsa-miR-4763-5p	CLIP-seq
MIRT2495715	hsa-miR-4773	CLIP-seq
MIRT2495716	hsa-miR-4775	CLIP-seq
MIRT2495717	hsa-miR-4794	CLIP-seq
MIRT2495718	hsa-miR-4797-5p	CLIP-seq
MIRT2495719	hsa-miR-4802-5p	CLIP-seq
MIRT2495720	hsa-miR-494	CLIP-seq
MIRT857896	hsa-miR-498	CLIP-seq
MIRT2495721	hsa-miR-508-3p	CLIP-seq
MIRT857897	hsa-miR-5095	CLIP-seq
MIRT2495722	hsa-miR-5096	CLIP-seq
MIRT2495723	hsa-miR-516b	CLIP-seq
MIRT2495724	hsa-miR-520d-5p	CLIP-seq
MIRT2495725	hsa-miR-524-5p	CLIP-seq
MIRT2495726	hsa-miR-541	CLIP-seq
MIRT2495727	hsa-miR-548l	CLIP-seq
MIRT2495728	hsa-miR-548n	CLIP-seq
MIRT2495729	hsa-miR-548p	CLIP-seq
MIRT2495730	hsa-miR-552	CLIP-seq
MIRT2495731	hsa-miR-590-3p	CLIP-seq
MIRT2495732	hsa-miR-592	CLIP-seq
MIRT2495733	hsa-miR-597	CLIP-seq
MIRT2495734	hsa-miR-650	CLIP-seq
MIRT2495735	hsa-miR-654-5p	CLIP-seq
MIRT2495736	hsa-miR-655	CLIP-seq
MIRT2495737	hsa-miR-670	CLIP-seq
MIRT2495738	hsa-miR-708	CLIP-seq
MIRT2495739	hsa-miR-767-3p	CLIP-seq
MIRT2495740	hsa-miR-767-5p	CLIP-seq
MIRT2495741	hsa-miR-885-3p	CLIP-seq
MIRT2495742	hsa-miR-922	CLIP-seq
MIRT2495743	hsa-miR-96	CLIP-seq
MIRT2677206	hsa-miR-1180	CLIP-seq
MIRT2495657	hsa-miR-1228	CLIP-seq
MIRT2495658	hsa-miR-1245b-3p	CLIP-seq
MIRT2495660	hsa-miR-125a-5p	CLIP-seq
MIRT2495661	hsa-miR-125b	CLIP-seq
MIRT2495667	hsa-miR-1825	CLIP-seq
MIRT2495669	hsa-miR-199a-5p	CLIP-seq
MIRT2495670	hsa-miR-199b-5p	CLIP-seq
MIRT2495671	hsa-miR-2053	CLIP-seq
MIRT2495672	hsa-miR-23a	CLIP-seq
MIRT2495673	hsa-miR-23b	CLIP-seq
MIRT2495674	hsa-miR-23c	CLIP-seq
MIRT2495678	hsa-miR-3117-5p	CLIP-seq
MIRT2192352	hsa-miR-3545-3p	CLIP-seq
MIRT2495691	hsa-miR-3934	CLIP-seq
MIRT2495692	hsa-miR-3938	CLIP-seq
MIRT2495693	hsa-miR-3940-5p	CLIP-seq
MIRT2495697	hsa-miR-4302	CLIP-seq
MIRT2495698	hsa-miR-4319	CLIP-seq
MIRT2495700	hsa-miR-4422	CLIP-seq
MIRT2677207	hsa-miR-448	CLIP-seq
MIRT2495701	hsa-miR-4506	CLIP-seq
MIRT2495702	hsa-miR-4507	CLIP-seq
MIRT2495705	hsa-miR-4661-5p	CLIP-seq
MIRT2495709	hsa-miR-4704-5p	CLIP-seq
MIRT2495711	hsa-miR-4732-3p	CLIP-seq
MIRT2495712	hsa-miR-4735-5p	CLIP-seq
MIRT2495716	hsa-miR-4775	CLIP-seq
MIRT2495717	hsa-miR-4794	CLIP-seq
MIRT2495718	hsa-miR-4797-5p	CLIP-seq
MIRT857897	hsa-miR-5095	CLIP-seq
MIRT2677208	hsa-miR-517b	CLIP-seq
MIRT2495730	hsa-miR-552	CLIP-seq
MIRT2495731	hsa-miR-590-3p	CLIP-seq
MIRT2495732	hsa-miR-592	CLIP-seq
MIRT2495733	hsa-miR-597	CLIP-seq
MIRT2495737	hsa-miR-670	CLIP-seq
MIRT2495739	hsa-miR-767-3p	CLIP-seq
MIRT2495740	hsa-miR-767-5p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005245	Function	Voltage-gated calcium channel activity	IDA	1309651
GO:0005245	Function	Voltage-gated calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	NAS	9594024
GO:0005515	Function	Protein binding	IPI	17525370, 18535142, 28130356, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	9594024
GO:0005886	Component	Plasma membrane	TAS
GO:0005891	Component	Voltage-gated calcium channel complex	IBA
GO:0005891	Component	Voltage-gated calcium channel complex	IDA	17224476
GO:0005891	Component	Voltage-gated calcium channel complex	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007528	Process	Neuromuscular junction development	TAS	8494331
GO:0007601	Process	Visual perception	IEA
GO:0008331	Function	High voltage-gated calcium channel activity	IDA	1309651
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0045933	Process	Positive regulation of muscle contraction	NAS	34072954
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	ISS	25533460
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	1309651
GO:0070509	Process	Calcium ion import	IDA	1309651
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	ISS
GO:0072659	Process	Protein localization to plasma membrane	ISS	25533460
GO:0086007	Function	Voltage-gated calcium channel activity involved in cardiac muscle cell action potential	IMP	17224476
GO:0086045	Process	Membrane depolarization during AV node cell action potential	IMP	17224476
GO:0086056	Function	Voltage-gated calcium channel activity involved in AV node cell action potential	IMP	17224476
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IMP	17224476
GO:0098684	Component	Photoreceptor ribbon synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098912	Process	Membrane depolarization during atrial cardiac muscle cell action potential	IMP	17224476
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:0099626	Function	Voltage-gated calcium channel activity involved in regulation of presynaptic cytosolic calcium levels	IEA
GO:1904879	Process	Positive regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS	25533460
GO:1990454	Component	L-type voltage-gated calcium channel complex	IDA	1309651
GO:1990454	Component	L-type voltage-gated calcium channel complex	ISS

MIM	HGNC	e!Ensembl
600003	1402	ENSG00000165995

Q08289

Protein name

Voltage-dependent L-type calcium channel subunit beta-2 (CAB2) (Calcium channel voltage-dependent subunit beta 2) (Lambert-Eaton myasthenic syndrome antigen B) (MYSB)

Protein function

Beta subunit of voltage-dependent calcium channels which contributes to the function of the calcium channel by increasing peak calcium current (By similarity). Plays a role in shifting voltage dependencies of activation and inactivation of the c

PDB

8HLP , 8HMA , 8HMB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12052	VGCC_beta4Aa_N	72 → 113	Voltage gated calcium channel subunit beta domain 4Aa N terminal	Domain
PF00625	Guanylate_kin	280 → 460	Guanylate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues.

Sequence

MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ

Sequence length

660

Interactions

View interactions

1131

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Brugada syndrome 4	Pathogenic	rs587777742	RCV000144246

Show/Hide Unknown Diseases (31)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Uncertain significance	rs12356533, rs750396182, rs875989812, rs147857449	RCV005920155 RCV005893900 RCV005893905 RCV005891828
Arrhythmogenic right ventricular cardiomyopathy	Conflicting classifications of pathogenicity	rs773215003	RCV000852429
Autism spectrum disorder	Uncertain significance	rs760538597	RCV000656707
Brugada syndrome	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	rs150528041, rs149253719, rs149793143, rs143326262, rs144182966, rs373932682, rs750396182, rs875989812, rs758274878, rs886046892, rs886046898, rs547804393, rs367928065, rs752637408, rs886046899 View all (16 more)	RCV000148448 RCV000852600 RCV000148452 RCV000148450 RCV000148451 RCV000590907 RCV000211477 RCV000211519 RCV000390587 RCV000275854 RCV000340972 RCV000266499 RCV000329978 RCV000342052 RCV000292032 RCV000356045 RCV000354385 RCV000363056 RCV000397009 RCV000263604 RCV000297165 RCV000375277 RCV000336097 RCV000406364 RCV000313836 RCV000344277 RCV000324332 RCV000360405 RCV000417288 RCV000590945 RCV000509348 RCV000678782
CACNB2-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	rs769211879, rs766267727, rs34813638, rs61733967, rs150528041, rs143326262, rs777478383, rs786205787, rs150722502, rs138060429, rs77141223, rs1241974896, rs2494909383, rs71402148, rs370040046 View all (4 more)	RCV003941087 RCV003403662 RCV003975098 RCV003975099 RCV004745214 RCV004745215 RCV003395574 RCV003398878 RCV003937528 RCV003907537 RCV003907536 RCV003416773 RCV003896573 RCV003917041 RCV003917152 RCV003958954 RCV003970363 RCV003965737 RCV003940482 RCV003895764
Cardiac arrest	Conflicting classifications of pathogenicity; Uncertain significance	rs200174877, rs730880059, rs869025371	RCV000157132 RCV000157131 RCV000208041
Cardiac arrhythmia	Benign; Conflicting classifications of pathogenicity	rs1554759973, rs1456201116	RCV001842509 RCV001842515
Cardiomyopathy	Conflicting classifications of pathogenicity; Benign; Likely benign	rs150528041, rs137886839, rs142639223, rs61733968	RCV000852599 RCV000852602 RCV000852603 RCV000852604
Cardiovascular phenotype	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	rs768218683, rs1344965960, rs140542975, rs889646922, rs148414498, rs142735478, rs1157722971, rs538160664, rs1348268646, rs1164299168, rs375218580, rs772796787, rs2132070434, rs571930944, rs1212860668 View all (350 more)	RCV002412001 RCV003166846 RCV002350603 RCV002366187 RCV002322256 RCV002402922 RCV002438819 RCV004995699 RCV005306424 RCV005792096 RCV002404839 RCV004995722 RCV002404974 RCV002395952 RCV002358904 RCV005792125 RCV002404950 RCV002341919 RCV004995803 RCV002449230 RCV002414093 RCV002432300 RCV002405104 RCV002324104 RCV002384863 RCV002405269 RCV002397964 RCV002386772 RCV004044796 RCV002397793 RCV002388796 RCV002386670 RCV002386795 RCV002334786 RCV005804330 RCV000621934 RCV000241586 RCV000620127 RCV000253056 RCV002407049 RCV002398095 RCV005308629 RCV003170304 RCV002425318 RCV002422998 RCV002388759 RCV004996056 RCV003303294 RCV002343984 RCV002425164 RCV004996075 RCV002391340 RCV002454520 RCV005535288 RCV002363618 RCV005535302 RCV002407327 RCV004990666 RCV004045807 RCV002363680 RCV002398253 RCV002391359 RCV002409551 RCV002361463 RCV002363678 RCV005308745 RCV000245027 RCV000617381 RCV000619766 RCV002354336 RCV000251462 RCV000619292 RCV002372024 RCV000243739 RCV002390371 RCV002454919 RCV002454923 RCV002346749 RCV002321275 RCV002333716 RCV002332116 RCV002457010 RCV002357655 RCV002323482 RCV002333959 RCV002335297 RCV002335389 RCV002338619 RCV002349532 RCV002340488 RCV002340523 RCV002347406 RCV002347468 RCV002335705 RCV002346773 RCV002340892 RCV002359652 RCV002360035 RCV002360131 RCV002370962 RCV002416915 RCV002373640 RCV002449773 RCV002373724 RCV002450045 RCV002371241 RCV002378429 RCV002409983 RCV002427986 RCV002378729 RCV002378767 RCV002385365 RCV002367352 RCV002384938 RCV002385093 RCV002421357 RCV002376281 RCV002385189 RCV002385194 RCV002385201 RCV002367148 RCV002371606 RCV002443404 RCV002387209 RCV002383059 RCV002383388 RCV002383540 RCV002392666 RCV002398317 RCV002398516 RCV002398573 RCV002403836 RCV002395126 RCV002395130 RCV002401459 RCV002376861 RCV002387347 RCV002387358 RCV002382858 RCV002385842 RCV002389237 RCV002389525 RCV002389531 RCV002389555 RCV002397080 RCV002397195 RCV002405633 RCV002395054 RCV002410099 RCV002410117 RCV002385441 RCV002389087 RCV002389135 RCV002394725 RCV002396756 RCV002406261 RCV002398930 RCV002398981 RCV002404086 RCV002380730 RCV002380860 RCV002400815 RCV002414518 RCV002405992 RCV002407625 RCV002401621 RCV002428438 RCV002457836 RCV002426221 RCV002437133 RCV002430688 RCV002429065 RCV002439357 RCV002435475 RCV002437835 RCV002435635 RCV002435931 RCV004992465 RCV005535516 RCV002336397 RCV000617740 RCV002381544 RCV002453580 RCV000620970 RCV000244354 RCV000618110 RCV000245105 RCV002399605 RCV002399604 RCV002399606 RCV002399607 RCV002408738 RCV000620280 RCV004071769 RCV002399613 RCV000619181 RCV003377902 RCV004992566 RCV000248968 RCV004990862 RCV004990858 RCV004067976 RCV004990874 RCV003375704 RCV004065968 RCV004603246 RCV002444814 RCV003170688 RCV004068661 RCV004129693 RCV004117197 RCV004144757 RCV004140811 RCV004160455 RCV004168995 RCV000249791 RCV000620776 RCV005532610 RCV000243143 RCV003168039 RCV003176646 RCV003176647 RCV003168040 RCV003176648 RCV003168041 RCV003168042 RCV003168043 RCV003176649 RCV003168044 RCV003176651 RCV004269519 RCV002390101 RCV000250713 RCV000250537 RCV000244767 RCV000254060 RCV000253796 RCV000247502 RCV000249316 RCV004283713 RCV004308840 RCV004318449 RCV003296808 RCV003296809 RCV003296810 RCV003296811 RCV003296812 RCV003296813 RCV003296814 RCV003296815 RCV003296816 RCV003296817 RCV003296818 RCV003296819 RCV003295976 RCV003305406 RCV004344497 RCV004356062 RCV004356704 RCV003379940 RCV003379941 RCV003379942 RCV003379937 RCV003379938 RCV003379939 RCV004360434 RCV004992605 RCV005794561 RCV005311046 RCV004992764 RCV006347829 RCV004021473 RCV000620453 RCV002402015 RCV002411192 RCV002450849 RCV000620685 RCV002392834 RCV002402016 RCV002446549 RCV004992169 RCV004432352 RCV004432353 RCV004432354 RCV004432355 RCV004520340 RCV004520341 RCV004520342 RCV004520343 RCV004520344 RCV004520345 RCV004520346 RCV004520347 RCV004520348 RCV004520349 RCV004520350 RCV004520351 RCV004520352 RCV004520353 RCV004520354 RCV004520355 RCV004520356 RCV004520357 RCV004520358 RCV004520359 RCV004520360 RCV004520361 RCV000619934 RCV005532651 RCV000618277 RCV002339105 RCV002379406 RCV003168714 RCV004022884 RCV000619640 RCV004023086 RCV000618611 RCV005306033 RCV002402365 RCV002374811 RCV002323810 RCV005318400 RCV002374812 RCV003298504 RCV000621687 RCV002431394 RCV002395156 RCV002395141 RCV002402382 RCV002438200 RCV000619491 RCV002395423 RCV002413575 RCV002413574 RCV004024095 RCV002367890 RCV002456360 RCV002395568 RCV000621914 RCV000621398 RCV000622006 RCV000618286 RCV000618417 RCV000621837 RCV000617349 RCV000617222 RCV000617371 RCV000620178 RCV000619434 RCV005791912 RCV002422348 RCV002397260 RCV002406418 RCV002386080 RCV002397259 RCV002397258 RCV002369717 RCV002397261 RCV005306112 RCV002449052 RCV002369809 RCV003303160 RCV002388284 RCV005306131 RCV002386233 RCV002440555 RCV002406597 RCV002406767 RCV004994051 RCV005791951 RCV002453932 RCV002332762 RCV002390758 RCV002416012 RCV002372440 RCV002381932 RCV002453988 RCV003307639 RCV003307647 RCV003169188 RCV002346048 RCV004994151 RCV002391042 RCV002400147 RCV004994174 RCV004994908 RCV002391068 RCV004994189 RCV003160538 RCV002400227 RCV002400217 RCV002451402 RCV004033811 RCV003294020 RCV004032539 RCV002379864 RCV002393563 RCV002402765 RCV002402788 RCV004036357 RCV004034138 RCV003166711
Cholangiocarcinoma	Benign; Uncertain significance	rs12357063, rs12356533, rs74120235, rs750396182, rs10741089	RCV005915774 RCV005920159 RCV005890597 RCV005893903 RCV005905471
Colorectal cancer	Benign	rs74120235	RCV005890594
Conduction system disorder	Uncertain significance	rs869025370	RCV000208390
Early repolarization associated with ventricular fibrillation	Conflicting classifications of pathogenicity	rs149253719	RCV000148449
Familial cancer of breast	Benign; Uncertain significance	rs12357063, rs750396182, rs875989812	RCV005915770 RCV005893899 RCV005893904
Gastric cancer	Benign; Uncertain significance	rs12356533, rs750396182, rs875989812	RCV005920157 RCV005893901 RCV005893908
Hypertrophic cardiomyopathy	Uncertain significance; Benign; Conflicting classifications of pathogenicity	rs761564584, rs61733968, rs199539261, rs145638628	RCV005356130 RCV000852604 RCV005355787 RCV005355788
Long QT syndrome	Conflicting classifications of pathogenicity	rs149253719, rs143326262, rs1456201116	RCV003318351 RCV003318352 RCV000208344
Lung cancer	Benign	rs12356533	RCV005920160
Malignant lymphoma, large B-cell, diffuse	Benign	rs12357063, rs4485000	RCV005915771 RCV005894400
Malignant tumor of esophagus	Benign; Uncertain significance; -	rs12356533, rs875989812, rs886046894, rs10741089	RCV005920156 RCV005893906 RCV006038737 RCV005905468
Paroxysmal familial ventricular fibrillation	Conflicting classifications of pathogenicity	rs200367454	RCV000148447
Primary dilated cardiomyopathy	Benign; Uncertain significance	rs61733968, rs1336353571	RCV000852604 RCV000498925
Sarcoma	Benign; Uncertain significance	rs74120235, rs875989812, rs10741089	RCV005890595 RCV005893907 RCV005905469
Short QT Syndrome 5	Benign; Uncertain significance	rs74120235, rs367619172	RCV000415639 RCV000415682
Sudden unexplained death	Conflicting classifications of pathogenicity; Uncertain significance	rs200367454, rs1339855749	RCV000999569 RCV000999612
Supraventricular tachycardia	Benign	rs61733968	RCV000852604
Thymoma	Benign; Uncertain significance	rs12357063, rs12356533, rs74120235, rs750396182, rs10741089	RCV005915773 RCV005920158 RCV005890596 RCV005893902 RCV005905470
Uterine carcinosarcoma	Benign	rs12357063	RCV005915772
Uterine corpus endometrial carcinoma	Benign	rs12357063, rs12356533, rs74120235, rs10741089	RCV005915775 RCV005920161 RCV005890598 RCV005905472
Ventricular fibrillation	Uncertain significance; Conflicting classifications of pathogenicity	rs730880058, rs374465425	RCV000157130 RCV000208153
Ventricular tachycardia	Conflicting classifications of pathogenicity; Benign	rs143326262, rs61733968	RCV000852601 RCV000852604

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anxiety	Associate	31181069
Arrhythmias Cardiac	Associate	27707468, 37378586
Atrial Fibrillation	Associate	24727801, 34737791
Autism Spectrum Disorder	Associate	24752249, 31887354, 35122502
Autistic Disorder	Associate	24752249, 31887354
Bifid nose	Associate	30395415
Bipolar Disorder	Associate	30744588, 40016690
Brain Diseases	Associate	40016690
Brugada Syndrome	Associate	27707468, 35955449
Calcium Metabolism Disorders	Associate	24752249
Cardiomyopathy Dilated	Associate	24339868
Cardiomyopathy Hypertrophic	Associate	28614222
Channelopathies	Associate	37378586
Depressive Disorder	Associate	31181069
Diabetes Mellitus Type 1	Associate	31439644
Diabetic Nephropathies	Associate	36401196
Diabetic Retinopathy	Associate	31439644
Ductus Arteriosus Patent	Associate	33837257
Essential Hypertension	Associate	32555714
Heart Diseases	Associate	24427266
Hypertension	Associate	25313554, 29982197, 32111194
Lymphoma B Cell Marginal Zone	Associate	25612624
Mental Disorders	Associate	23453885, 24752249, 26798408, 34273149
Migraine Disorders	Associate	34273149
Mucocutaneous Lymph Node Syndrome	Associate	30395415
Schizophrenia	Associate	23453885
Squamous Cell Carcinoma of Head and Neck	Associate	34201353
Sudden Unexpected Death in Epilepsy	Associate	34816733
Timothy syndrome	Associate	24752249
Ventricular Fibrillation	Associate	35955449

CACNB2 (calcium voltage-gated channel auxiliary subunit beta 2)