Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	728
Gene name Gene Name - the full gene name approved by the HGNC.	Complement C5a receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	C5AR1
Synonyms (NCBI Gene) Gene synonyms aliases	C5A, C5AR, C5R1, CD88
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32

Show/Hide all(84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019124	hsa-miR-335-5p	Microarray	18185580
MIRT030190	hsa-miR-26b-5p	Microarray	19088304
MIRT848590	hsa-miR-1262	CLIP-seq
MIRT848591	hsa-miR-1343	CLIP-seq
MIRT848592	hsa-miR-3179	CLIP-seq
MIRT848593	hsa-miR-339-5p	CLIP-seq
MIRT848594	hsa-miR-3689a-3p	CLIP-seq
MIRT848595	hsa-miR-3689c	CLIP-seq
MIRT848596	hsa-miR-3907	CLIP-seq
MIRT848597	hsa-miR-3945	CLIP-seq
MIRT848598	hsa-miR-4253	CLIP-seq
MIRT848599	hsa-miR-4447	CLIP-seq
MIRT848600	hsa-miR-4450	CLIP-seq
MIRT848601	hsa-miR-4472	CLIP-seq
MIRT848602	hsa-miR-4503	CLIP-seq
MIRT848603	hsa-miR-4505	CLIP-seq
MIRT848604	hsa-miR-4651	CLIP-seq
MIRT848605	hsa-miR-4667-5p	CLIP-seq
MIRT848606	hsa-miR-4700-5p	CLIP-seq
MIRT848607	hsa-miR-4701-3p	CLIP-seq
MIRT848608	hsa-miR-4713-3p	CLIP-seq
MIRT848609	hsa-miR-4728-5p	CLIP-seq
MIRT848610	hsa-miR-4731-3p	CLIP-seq
MIRT848611	hsa-miR-4793-5p	CLIP-seq
MIRT848612	hsa-miR-4801	CLIP-seq
MIRT848613	hsa-miR-485-5p	CLIP-seq
MIRT848614	hsa-miR-608	CLIP-seq
MIRT848590	hsa-miR-1262	CLIP-seq
MIRT1951754	hsa-miR-150	CLIP-seq
MIRT848592	hsa-miR-3179	CLIP-seq
MIRT848597	hsa-miR-3945	CLIP-seq
MIRT848598	hsa-miR-4253	CLIP-seq
MIRT1951755	hsa-miR-4438	CLIP-seq
MIRT848603	hsa-miR-4505	CLIP-seq
MIRT848607	hsa-miR-4701-3p	CLIP-seq
MIRT848610	hsa-miR-4731-3p	CLIP-seq
MIRT848612	hsa-miR-4801	CLIP-seq
MIRT848613	hsa-miR-485-5p	CLIP-seq
MIRT1951756	hsa-miR-5095	CLIP-seq
MIRT1951757	hsa-miR-579	CLIP-seq
MIRT1951758	hsa-miR-664	CLIP-seq
MIRT2189639	hsa-miR-1208	CLIP-seq
MIRT2189640	hsa-miR-1224-3p	CLIP-seq
MIRT848590	hsa-miR-1262	CLIP-seq
MIRT2189641	hsa-miR-145	CLIP-seq
MIRT2189642	hsa-miR-197	CLIP-seq
MIRT2189643	hsa-miR-24	CLIP-seq
MIRT2189644	hsa-miR-2681	CLIP-seq
MIRT848592	hsa-miR-3179	CLIP-seq
MIRT2189645	hsa-miR-4269	CLIP-seq
MIRT2189646	hsa-miR-4284	CLIP-seq
MIRT2189647	hsa-miR-4420	CLIP-seq
MIRT1951755	hsa-miR-4438	CLIP-seq
MIRT2189648	hsa-miR-4466	CLIP-seq
MIRT848603	hsa-miR-4505	CLIP-seq
MIRT848607	hsa-miR-4701-3p	CLIP-seq
MIRT848610	hsa-miR-4731-3p	CLIP-seq
MIRT848612	hsa-miR-4801	CLIP-seq
MIRT2189649	hsa-miR-483-5p	CLIP-seq
MIRT848613	hsa-miR-485-5p	CLIP-seq
MIRT1951756	hsa-miR-5095	CLIP-seq
MIRT2189650	hsa-miR-640	CLIP-seq
MIRT2189651	hsa-miR-675	CLIP-seq
MIRT2189652	hsa-miR-935	CLIP-seq
MIRT848590	hsa-miR-1262	CLIP-seq
MIRT848592	hsa-miR-3179	CLIP-seq
MIRT848603	hsa-miR-4505	CLIP-seq
MIRT848607	hsa-miR-4701-3p	CLIP-seq
MIRT848610	hsa-miR-4731-3p	CLIP-seq
MIRT848612	hsa-miR-4801	CLIP-seq
MIRT848613	hsa-miR-485-5p	CLIP-seq
MIRT2189648	hsa-miR-4466	CLIP-seq
MIRT2189651	hsa-miR-675	CLIP-seq
MIRT2189644	hsa-miR-2681	CLIP-seq
MIRT2493288	hsa-miR-4301	CLIP-seq
MIRT2189648	hsa-miR-4466	CLIP-seq
MIRT2493289	hsa-miR-4775	CLIP-seq
MIRT2493290	hsa-miR-590-3p	CLIP-seq
MIRT2189651	hsa-miR-675	CLIP-seq
MIRT2676954	hsa-miR-129-5p	CLIP-seq
MIRT2189648	hsa-miR-4466	CLIP-seq
MIRT2493289	hsa-miR-4775	CLIP-seq
MIRT2493290	hsa-miR-590-3p	CLIP-seq
MIRT2189651	hsa-miR-675	CLIP-seq

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS	7649993
GO:0001774	Process	Microglial cell activation	ISS
GO:0001856	Function	Complement component C5a binding	IEA
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA	21873635
GO:0004875	Function	Complement receptor activity	IBA	21873635
GO:0004878	Function	Complement component C5a receptor activity	IBA	21873635
GO:0004878	Function	Complement component C5a receptor activity	IDA	10571060, 22496247
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IPI	10571060
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	2007135
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	TAS	10352266
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	TAS	9590258
GO:0006968	Process	Cellular defense response	TAS	8779720
GO:0007165	Process	Signal transduction	TAS	2007135, 8702752
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007202	Process	Activation of phospholipase C activity	TAS	7649993
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007606	Process	Sensory perception of chemical stimulus	TAS	9590258
GO:0009986	Component	Cell surface	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	22960554
GO:0021534	Process	Cell proliferation in hindbrain	IEA
GO:0030449	Process	Regulation of complement activation	TAS
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0032494	Process	Response to peptidoglycan	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0038178	Process	Complement component C5a signaling pathway	IDA	10571060
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	22496247
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045177	Component	Apical part of cell	IDA	22496247
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0048143	Process	Astrocyte activation	ISS
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	22496247
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050890	Process	Cognition	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	22496247
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097242	Process	Amyloid-beta clearance	ISS
GO:0099172	Process	Presynapse organization	ISS
GO:1902947	Process	Regulation of tau-protein kinase activity	ISS

MIM	HGNC	e!Ensembl
113995	1338	ENSG00000197405

Protein

UniProt ID

P21730

Protein name

C5a anaphylatoxin chemotactic receptor 1 (C5a anaphylatoxin chemotactic receptor) (C5a-R) (C5aR) (CD antigen CD88)

Protein function

Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a (PubMed:10636859, PubMed:15153520, PubMed:1847994, PubMed:29300009, PubMed:7622471, PubMed:8182049, PubMed:9553099). The ligand interacts with at least two sites on the rece

PDB

2K3U , 5O9H , 6C1Q , 6C1R , 7Y64 , 7Y65 , 7Y66 , 7Y67 , 8GO8 , 8GOO , 8HK5 , 8I0N , 8I0Z , 8IA2 , 8JZP , 8JZZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	54 → 300	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

Sequence length

350

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Periodontitis	Periodontitis			GWAS

Show/Hide Text Mining Associations (168)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Spontaneous	Stimulate	24802103
Acute Kidney Injury	Stimulate	30451738
Alzheimer Disease	Associate	23394121, 30403186
Alzheimer Disease	Stimulate	37679689
Alzheimer Disease 15	Associate	23394121
AMR Syndrome	Associate	38128610
Amyotrophic Lateral Sclerosis	Associate	33216044
Anaphylaxis	Associate	16301808
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	22691190
Antiphospholipid Syndrome	Associate	16982920
Aortic Aneurysm Abdominal	Associate	33332020
Appendicitis	Associate	10027407
Arthritis Psoriatic	Associate	25725109
Arthritis Psoriatic	Stimulate	29220376
Arthritis Rheumatoid	Stimulate	25725109, 29220376
Asthma	Associate	16301808
Astrocytoma	Associate	10349852
Atherosclerosis	Associate	32787365, 40053030
Atrial Fibrillation	Associate	32389013, 35919038
Atrophy	Associate	11422745
Atypical Hemolytic Uremic Syndrome	Associate	34852172
Autoimmune Diseases	Associate	29138505
Autoimmune Diseases of the Nervous System	Associate	29874282
Bacterial Infections	Associate	34852172
Biliary Atresia	Associate	36333281
Blood Coagulation Disorders	Associate	16982920
Blood Platelet Disorders	Associate	32759504, 34852172, 35309299
Brachydactyly Type D	Stimulate	28504607
Brain Damage Chronic	Inhibit	39457022
Brain Death	Stimulate	23398742
Brain Injuries	Associate	37308987
Brain Injuries Traumatic	Stimulate	37308987
Bronchopneumonia	Associate	10027407
Calcinosis	Associate	38242312
Calcinosis Cutis	Associate	29327939
Carcinogenesis	Associate	35649359
Carcinoma Hepatocellular	Associate	33176600
Carcinoma Non Small Cell Lung	Associate	29327939, 36323738
Carcinoma Renal Cell	Associate	32345771, 34221297, 36883235, 36902242
Carotid Stenosis	Associate	32927275, 36823662
Cartilage Diseases	Associate	38242312
Ciliary Motility Disorders	Stimulate	29116124
Clear cell metastatic renal cell carcinoma	Associate	36883235
Colorectal Neoplasms	Associate	35649359, 36192575, 36571232, 38307957
Compassion Fatigue	Stimulate	37308987
Complement Factor H Deficiency	Stimulate	29874282
Coronary Artery Disease	Associate	25924896, 27025272, 30258440
COVID 19	Associate	33453462, 33845430, 34852172, 35309299, 36087611, 38511328
COVID 19	Stimulate	40016722
Critical Illness	Inhibit	19324972
Crohn Disease	Associate	10027407
Dementia Vascular	Associate	23394121
Dermatitis Allergic Contact	Associate	16778800
Dermatitis Atopic	Associate	11251879
Dermatitis Atopic 1	Associate	9864003
Dermatitis Contact	Associate	16778800
Diabetic Angiopathies	Associate	35309299
Diabetic Retinopathy	Associate	24265019
Diffuse Neurofibrillary Tangles with Calcification	Associate	23394121
Endometrial Neoplasms	Associate	33606748
Fabry Disease	Associate	38304433
Gastrointestinal Stromal Tumors	Associate	33606748
Gaucher Disease	Associate	34576075
Glioblastoma	Associate	32179921, 36230961
Glioma	Associate	33059718
Gliosis	Associate	9006319
Glomerulonephritis	Associate	11422745
Glomerulonephritis	Stimulate	37713183
Glomerulonephritis Membranous	Associate	11422745
Glycogen Storage Disease Type II	Associate	25214719
Glycosuria Renal	Associate	22691190
Granuloma Pyogenic	Associate	10027407
Gray Platelet Syndrome	Stimulate	28707765
Guillain Barre Syndrome	Associate	34852172
HELLP Syndrome	Associate	34697959
Hemorrhage	Associate	40053030
Hepatitis B Chronic	Stimulate	23113588, 30602374
Hidradenitis Suppurativa	Associate	36211440
HIV Infections	Stimulate	26537334
HTLV I Infections	Associate	11139191
Hyperglycemia	Stimulate	24265019
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	36982499
Idiopathic Pulmonary Fibrosis	Associate	24958208
IgA Vasculitis	Associate	25725109, 40717085
IgA Vasculitis	Stimulate	25760949, 29220376
Immune System Diseases	Associate	36508191
Immunologic Deficiency Syndromes	Stimulate	28652401
Immunologic Deficiency Syndromes	Associate	29874282
Infections	Stimulate	26537334
Inflammation	Associate	10349852, 11422745, 16301808, 22674410, 23394121, 23398742, 25214719, 25924896, 26626217, 30258440, 32787365, 33606748, 34576075, 36122756, 36293087, 36508191, 37890688, 40717085, 9006319 View all (4 more)
Inflammation	Stimulate	33803624, 33845430
Insulin Resistance	Associate	37890688
Job Syndrome	Associate	6616960
Kidney Diseases	Associate	11422745, 37862725
Lead Poisoning Nervous System	Associate	26565031
Leukemia Erythroblastic Acute	Associate	14551213, 23346183
Leukemia Lymphoma Adult T Cell	Associate	23557330
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23642027
Leukemia Myeloid Acute	Associate	30955242
Lichen Planus	Associate	10027407
Liver Cirrhosis	Associate	23113588
Lung Neoplasms	Associate	16301808, 29327939
Lupus Erythematosus Cutaneous	Associate	16778800
Lupus Erythematosus Systemic	Associate	16778800, 25339666, 26059553
Lupus Erythematosus Systemic	Inhibit	24902963
Lupus Nephritis	Associate	11422745, 36521939
Macular Degeneration	Associate	19661236, 20484595, 26565031, 26746578
Macular Degeneration	Stimulate	21762495
Mast Cell Activation Disorders	Associate	12542483
Mastocytosis Systemic	Associate	12542483
Mesangial sclerosis diffuse	Associate	11422745
Mouth Diseases	Associate	28707765
Multiple Sclerosis	Associate	38218802
Myocardial Infarction	Stimulate	32389013
Myocardial Infarction	Associate	34799616
Nasopharyngeal Carcinoma	Associate	29685955
Neoplasm Metastasis	Associate	29327939
Neoplasms	Stimulate	23672538
Neoplasms	Associate	29327939, 29685955, 33606748, 35137541, 36323738, 36508191, 36883235, 37791232, 37824211
Neoplasms	Inhibit	33256375
Neoplasms Adipose Tissue	Associate	24523571
Neoplasms Vascular Tissue	Associate	38242312
Nephrosis Lipoid	Associate	11422745
Neurodegenerative Diseases	Associate	26059553
Neuroinflammatory Diseases	Associate	26059553
Neuromyelitis Optica	Inhibit	39457022
Neutropenia	Stimulate	9507227
Neutrophil Actin Dysfunction	Associate	19324972
Neutrophil Immunodeficiency Syndrome	Associate	15191561
Neutrophil Immunodeficiency Syndrome	Inhibit	19324972
Non ST Elevated Myocardial Infarction	Associate	30258440
Obesity	Associate	37890688
Osteoarthritis	Associate	35406699, 38242312
Osteolysis	Associate	29327939
Ovarian Neoplasms	Associate	32316695, 36722270, 37791232, 40225866
Parkinson Disease	Inhibit	33216044
Pemphigus	Associate	23505434
Pemphigus	Stimulate	31211854
Periodontitis	Associate	38218802
Pleural Effusion Malignant	Associate	35137541
Polycystic Ovary Syndrome	Associate	36293087
Pre Eclampsia	Stimulate	19900030
Pulmonary Embolism	Stimulate	23726092
Pulpitis	Associate	36732060
Rectal Neoplasms	Associate	39278399
Respiratory Distress Syndrome	Associate	18490736, 19635508
Respiratory Sounds	Inhibit	18614563
Retinal Degeneration	Associate	26565031
Retinal Diseases	Associate	24265019
Retinitis	Associate	26565031
Sarcoidosis	Associate	19077082
Severe Acute Respiratory Syndrome	Associate	19635508
Skin Diseases	Associate	10027407
Small Cell Lung Carcinoma	Stimulate	33606748
Soft Tissue Injuries	Associate	11422745
ST Elevation Myocardial Infarction	Stimulate	30258440
Stevens Johnson Syndrome	Stimulate	31795786
Stomach Neoplasms	Associate	27756879, 36508191, 38425243
Substance Related Disorders	Associate	36571232
Tendinopathy	Associate	33803624
Thrombosis	Associate	16879222, 20424189
Thyroid Neoplasms	Stimulate	33606748
Tuberculosis	Associate	10027407
Vascular Diseases	Associate	34852172
Vasculitis	Inhibit	22691190
Virus Diseases	Associate	34852172
Wilms Tumor	Associate	33059718
Wounds and Injuries	Associate	30451738

C5AR1 (complement C5a receptor 1)