Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	596
Gene name	BCL2 apoptosis regulator
Gene symbol	BCL2
Synonyms (NCBI Gene)	Bcl-2PPP1R50
Chromosome	18
Chromosome location	18q21.33
Summary	This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be t

942

Show/Hide all (942)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003011	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT003011	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	18803879
MIRT000065	hsa-miR-34b-5p	Luciferase reporter assay	18803879
MIRT003979	hsa-miR-34c-5p	Luciferase reporter assay	18803879
MIRT002298	hsa-miR-34a-5p	qRT-PCRWestern blot	18803879
MIRT003980	hsa-miR-33b-5p	qRT-PCRWestern blot	18803879
MIRT003979	hsa-miR-34c-5p	qRT-PCRWestern blot	18803879
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	18449891
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCRWestern blot	18449891
MIRT002298	hsa-miR-34a-5p	qRT-PCRWestern blot	18505919
MIRT002298	hsa-miR-34a-5p	qRT-PCRLuciferase reporter assayWestern blot	18803879
MIRT000065	hsa-miR-34b-5p	qRT-PCRLuciferase reporter assayWestern blot	18803879
MIRT003979	hsa-miR-34c-5p	qRT-PCRLuciferase reporter assayWestern blot	18803879
MIRT000815	hsa-miR-15a-5p	qRT-PCR	18362358
MIRT001800	hsa-miR-16-5p	qRT-PCRproteomics analysis	18362358
MIRT000815	hsa-miR-15a-5p	proteomics analysis	18362358
MIRT002298	hsa-miR-34a-5p	ReviewLuciferase reporter assay	19461653
MIRT002298	hsa-miR-34a-5p	ReviewLuciferase reporter assayWestern blotMicroarray	17914404
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay	17707831
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assay	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17351108
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17707831
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay	19074899
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	17072344
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	18505919
MIRT000815	hsa-miR-15a-5p	Review	19815577
MIRT000392	hsa-miR-1-3p	Review	19815577
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003499	hsa-miR-181c-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003499	hsa-miR-181c-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003498	hsa-miR-181d-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT003498	hsa-miR-181d-5p	Luciferase reporter assayqRT-PCRWestern blot	20162574
MIRT002298	hsa-miR-34a-5p	Review	20130964
MIRT003449	hsa-miR-34b-3p	Review	20130964
MIRT003979	hsa-miR-34c-5p	Review	20130964
MIRT001800	hsa-miR-16-5p	Review	20130964
MIRT001800	hsa-miR-16-5p	Review	20029422
MIRT003291	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	20041405
MIRT003291	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	20041405
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	20041405
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	20041405
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCRWestern blot	20041405
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCRWestern blot	20041405
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay	19478946
MIRT001800	hsa-miR-16-5p	ImmunohistochemistryMicroarrayWestern blot	20643754
MIRT000815	hsa-miR-15a-5p	Western blot	20876285
MIRT001800	hsa-miR-16-5p	Western blot	20876285
MIRT000815	hsa-miR-15a-5p	MicroarrayqRT-PCR	17260024
MIRT000418	hsa-let-7a-5p	MicroarrayqRT-PCR	17260024
MIRT000418	hsa-let-7a-5p	MicroarrayqRT-PCR	17260024
MIRT000418	hsa-let-7a-5p	MicroarrayqRT-PCR	17260024
MIRT004844	hsa-miR-192-5p	Luciferase reporter assayqRT-PCR	19074876
MIRT005362	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blot	20727858
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCRWestern blot	16166262
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	16166262
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayWestern blot	19269153
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assayMicroarrayWestern blot	17656095
MIRT000290	hsa-miR-153-3p	Luciferase reporter assayWestern blot	19676043
MIRT000290	hsa-miR-153-3p	Luciferase reporter assayWestern blot	19676043
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	19683563
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	19683563
MIRT000815	hsa-miR-15a-5p	Western blot	19903841
MIRT001800	hsa-miR-16-5p	Western blot	19903841
MIRT002298	hsa-miR-34a-5p	FlowImmunoblotLuciferase reporter assay	20598588
MIRT005578	hsa-miR-630	ImmunoblotLuciferase reporter assayqRT-PCR	21274007
MIRT005744	hsa-miR-451a	qRT-PCRWestern blot	20816946
MIRT005744	hsa-miR-451a	qRT-PCRWestern blot	20816946
MIRT000159	hsa-miR-21-5p	Luciferase reporter assayWestern blot	21376256
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assayWestern blot	22072615
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assayWestern blot	22072615
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22293115
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22293115
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006445	hsa-miR-449a	ChIP-seqLuciferase reporter assay	21569010
MIRT000159	hsa-miR-21-5p	Luciferase reporter assayWestern blot	21376256
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assayWestern blot	22072615
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assayWestern blot	22072615
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22293115
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22293115
MIRT000159	hsa-miR-21-5p	qRT-PCRWestern blot	22528454
MIRT000159	hsa-miR-21-5p	Luciferase reporter assayWestern blot	21376256
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assayWestern blot	22072615
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assayWestern blot	22072615
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22293115
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22293115
MIRT000159	hsa-miR-21-5p	qRT-PCRWestern blot	22528454
MIRT003498	hsa-miR-181d-5p	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22207524
MIRT003498	hsa-miR-181d-5p	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22207524
MIRT003498	hsa-miR-181d-5p	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22207524
MIRT003498	hsa-miR-181d-5p	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22207524
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22209977
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22209977
MIRT006670	hsa-miR-200b-3p	Luciferase reporter assayqRT-PCRWestern blot	21993663
MIRT006673	hsa-miR-200c-3p	Luciferase reporter assayqRT-PCRWestern blot	21993663
MIRT006674	hsa-miR-429	Luciferase reporter assayqRT-PCRWestern blot	21993663
MIRT003501	hsa-miR-181a-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21958558
MIRT003501	hsa-miR-181a-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21958558
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	22710123
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	22710123
MIRT006868	hsa-miR-136-5p	Luciferase reporter assay	22967897
MIRT006868	hsa-miR-136-5p	Luciferase reporter assay	22967897
MIRT006904	hsa-miR-7-5p	GFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	21750649
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22610076
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assay	22610076
MIRT006975	hsa-miR-148a-3p	Luciferase reporter assay	21455217
MIRT006975	hsa-miR-148a-3p	Luciferase reporter assay	21455217
MIRT006977	hsa-miR-24-2-5p	Luciferase reporter assay	21463514
MIRT007063	hsa-miR-182-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22848417
MIRT007063	hsa-miR-182-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22848417
MIRT007063	hsa-miR-182-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	22848417
MIRT007146	hsa-miR-196b-5p	Immunocytochemistry	23293219
MIRT007348	hsa-miR-143-3p	Western blot	23276710
MIRT003498	hsa-miR-181d-5p	Reporter assay;Western blot;Other	20162574
MIRT019975	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT000290	hsa-miR-153-3p	Reporter assay	19676043
MIRT007348	hsa-miR-143-3p	Western blot	19843160
MIRT000978	hsa-miR-15b-5p	Reporter assay	18449891
MIRT000978	hsa-miR-15b-5p	Reporter assay;Other	18449891
MIRT024494	hsa-miR-215-5p	Microarray	19074876
MIRT003499	hsa-miR-181c-5p	Reporter assay;Western blot;Other	20162574
MIRT003500	hsa-miR-181b-5p	Reporter assay;Western blot;Other	20162574
MIRT003501	hsa-miR-181a-5p	Reporter assay;Western blot;Other	20162574
MIRT002298	hsa-miR-34a-5p	Reporter assay;Other	21399894
MIRT002298	hsa-miR-34a-5p	Proteomics	21566225
MIRT002298	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR;Other	19683563
MIRT002298	hsa-miR-34a-5p	Reporter assay	20598588
MIRT006904	hsa-miR-7-5p	Reporter assay;Western blot;qRT-PCR;Other	21750649
MIRT004844	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT027158	hsa-miR-103a-3p	Sequencing	20371350
MIRT027929	hsa-miR-96-5p	Sequencing	20371350
MIRT000159	hsa-miR-21-5p	Western blot	21468550
MIRT000159	hsa-miR-21-5p	Western blot;Other	20048743
MIRT001800	hsa-miR-16-5p	Reporter assay	18449891
MIRT001800	hsa-miR-16-5p	Sequencing	20371350
MIRT001800	hsa-miR-16-5p	Western blot	16166262
MIRT001800	hsa-miR-16-5p	Reporter assay	18449891
MIRT000815	hsa-miR-15a-5p	Western blot	16166262
MIRT052936	hsa-miR-205-5p	ImmunohistochemistryqRT-PCRWestern blot	24297308
MIRT007348	hsa-miR-143-3p	5.0	22160209
MIRT007348	hsa-miR-143-3p	5.0	22160209
MIRT007348	hsa-miR-143-3p	Luciferase reporter assayqRT-PCRWestern blot	22160209
MIRT000192	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blot	22892391
MIRT053253	hsa-miR-126-3p	In situ hybridizationLuciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23603512
MIRT005362	hsa-miR-195-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23451060
MIRT003014	hsa-miR-17-5p	Luciferase reporter assayqRT-PCRWestern blot	24280866
MIRT053297	hsa-miR-18a-5p	Luciferase reporter assayqRT-PCRWestern blot	24280866
MIRT053471	hsa-miR-497-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21258880
MIRT000192	hsa-miR-204-5p	ImmunohistochemistryMicroarrayqRT-PCRWestern blot	23152059
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	23907579
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	23907579
MIRT006445	hsa-miR-449a	FlowLuciferase reporter assayqRT-PCRWestern blot	24248414
MIRT006445	hsa-miR-449a	FlowLuciferase reporter assayqRT-PCRWestern blot	24248414
MIRT006445	hsa-miR-449a	Luciferase reporter assayqRT-PCRWestern blot	24260067
MIRT007348	hsa-miR-143-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25492481
MIRT002298	hsa-miR-34a-5p	qRT-PCRWestern blot	24565525
MIRT000159	hsa-miR-21-5p	ChIP-seqImmunofluorescenceWestern blot	24606718
MIRT437391	hsa-miR-708-5p	FlowqRT-PCRWestern blot	23754151
MIRT052936	hsa-miR-205-5p	Luciferase reporter assayWestern blot	23612742
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT002298	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT000192	hsa-miR-204-5p	qRT-PCRWestern blot	24960059
MIRT000192	hsa-miR-204-5p	qRT-PCRWestern blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCRWestern blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCRWestern blot	24960059
MIRT369727	hsa-miR-448	qRT-PCRWestern blot	24960059
MIRT369727	hsa-miR-448	qRT-PCRWestern blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCRWestern blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCRWestern blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCRWestern blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCRWestern blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCRWestern blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCRWestern blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCRWestern blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCRWestern blot	24960059
MIRT003501	hsa-miR-181a-5p	ImmunoblotqRT-PCRWestern blot	24002437
MIRT438662	hsa-miR-503-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	23856992
MIRT438662	hsa-miR-503-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	23856992
MIRT438617	hsa-miR-224-5p	MicroarrayqRT-PCRWestern blot	22989374
MIRT003291	hsa-miR-29a-3p	qRT-PCR	25006537
MIRT003290	hsa-miR-29b-3p	qRT-PCR	25006537
MIRT001800	hsa-miR-16-5p	Western blot	24148817
MIRT199194	hsa-miR-206	FlowqRT-PCR	24855559
MIRT438304	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCR	25230140
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	24335172
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay	23894561
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay	23894561
MIRT007063	hsa-miR-182-5p	qRT-PCR	23936432
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISAGFP reporter assayLuciferase reporter assayqRT-PCRWestern blot	23440261
MIRT002298	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT000192	hsa-miR-204-5p	qRT-PCRWestern blot	24960059
MIRT000192	hsa-miR-204-5p	qRT-PCRWestern blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCRWestern blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCRWestern blot	24960059
MIRT369727	hsa-miR-448	qRT-PCRWestern blot	24960059
MIRT369727	hsa-miR-448	qRT-PCRWestern blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCRWestern blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCRWestern blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCRWestern blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCRWestern blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCRWestern blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCRWestern blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCRWestern blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCRWestern blot	24960059
MIRT003501	hsa-miR-181a-5p	ImmunoblotqRT-PCRWestern blot	24002437
MIRT438662	hsa-miR-503-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	23856992
MIRT438662	hsa-miR-503-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	23856992
MIRT438617	hsa-miR-224-5p	MicroarrayqRT-PCRWestern blot	22989374
MIRT003291	hsa-miR-29a-3p	qRT-PCR	25006537
MIRT003290	hsa-miR-29b-3p	qRT-PCR	25006537
MIRT001800	hsa-miR-16-5p	Western blot	24148817
MIRT199194	hsa-miR-206	FlowqRT-PCR	24855559
MIRT438304	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCR	25230140
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	24335172
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay	23894561
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay	23894561
MIRT007063	hsa-miR-182-5p	qRT-PCR	23936432
MIRT000815	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT000978	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT001800	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT005362	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT000159	hsa-miR-21-5p	Luciferase reporter assayWestern blot	25327529
MIRT001800	hsa-miR-16-5p	ImmunoprecipitaionqRT-PCRImmunoblotWestern blot	25435430
MIRT002298	hsa-miR-34a-5p	5.0	26802970
MIRT002298	hsa-miR-34a-5p	5.0	26802970
MIRT002298	hsa-miR-34a-5p	qRT-PCRWestern blot	27939626
MIRT003499	hsa-miR-181c-5p	GFP reporter assayqRT-PCRWestern blot	25898913
MIRT000978	hsa-miR-15b-5p	qRT-PCRWestern blot	26884837
MIRT002298	hsa-miR-34a-5p	FlowQRTPCRWestern blot	26406332
MIRT438662	hsa-miR-503-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24931256
MIRT438662	hsa-miR-503-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24931256
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	26297542
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	26297542
MIRT006674	hsa-miR-429	Luciferase reporter assayqRT-PCRWestern blot	26513239
MIRT006674	hsa-miR-429	Luciferase reporter assayqRT-PCRWestern blot	26513239
MIRT438753	hsa-miR-9-5p	Luciferase reporter assayWestern blot	26660116
MIRT732216	hsa-miR-9-5p	Luciferase reporter assayWestern blot	26660116
MIRT732232	hsa-miR-139-5p	Luciferase reporter assayqRT-PCRWestern blot	27244080
MIRT732232	hsa-miR-139-5p	Luciferase reporter assayqRT-PCRWestern blot	27244080
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	27802900
MIRT005362	hsa-miR-195-5p	qRT-PCRWestern blot	26064276
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCRWestern blot	26550150
MIRT003979	hsa-miR-34c-5p	Next Generation Sequencing (NGS)qRT-PCRWestern blot	26795575
MIRT000192	hsa-miR-204-5p	Luciferase reporter assayWestern blot	28280358
MIRT000192	hsa-miR-204-5p	Luciferase reporter assayWestern blot	28280358
MIRT006253	hsa-miR-125b-5p	ELISAqRT-PCR	26057745
MIRT053471	hsa-miR-497-5p	Luciferase reporter assayqRT-PCRWestern blot	26339338
MIRT053471	hsa-miR-497-5p	Luciferase reporter assayqRT-PCRWestern blot	26339338
MIRT000815	hsa-miR-15a-5p	Western blot	26397135
MIRT001800	hsa-miR-16-5p	Western blot	26397135
MIRT000192	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blot	27519795
MIRT000192	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blot	27519795
MIRT006904	hsa-miR-7-5p	qRT-PCRWestern blot	26464649
MIRT006904	hsa-miR-7-5p	qRT-PCRWestern blot	26464649
MIRT006904	hsa-miR-7-5p	qRT-PCRWestern blot	26464649
MIRT006904	hsa-miR-7-5p	qRT-PCRWestern blot	26464649
MIRT438662	hsa-miR-503-5p	ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	28343379
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	25910896
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	25910896
MIRT001800	hsa-miR-16-5p	MicroarrayqRT-PCRWestern blot	26722459
MIRT735442	hsa-miR-15a-3p	qRT-PCRWestern blot	27596960
MIRT735443	hsa-miR-16-1-3p	qRT-PCRWestern blot	27596960
MIRT732589	hsa-miR-133a-3p	ImmunofluorescenceqRT-PCRWestern blotting	33639970
MIRT000815	hsa-miR-15a-5p	RNA-seqqRT-PCR	32266559
MIRT002298	hsa-miR-34a-5p	qRT-PCR	33773546
MIRT438662	hsa-miR-503-5p	qRT-PCRWestern blotting	33262626
MIRT000159	hsa-miR-21-5p	RNA-seqqRT-PCR	34209741
MIRT005362	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blotting	31807149
MIRT005362	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blotting	31807149
MIRT001800	hsa-miR-16-5p	Immunohistochemistry (IHC)qRT-PCRWestern blotting	33122919
MIRT733640	hsa-miR-140-3p	ImmunofluorescenceLuciferase reporter assayWestern blotting	33953572
MIRT733816	hsa-miR-451b	qRT-PCRWestern blotting	33725258
MIRT199222	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT003014	hsa-miR-17-5p	qRT-PCR	31797280
MIRT733640	hsa-miR-140-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	33838016
MIRT734377	hsa-miR-155-5p	qRT-PCR	32507875
MIRT734524	hsa-miR-1183	ELISAImmunocytochemistry (ICC)Luciferase reporter assayqRT-PCR	33073840
MIRT002298	hsa-miR-34a-5p	Western blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCRFlow cytometry	32161722
MIRT734923	hsa-miR-145-3p	qRT-PCR	33250681
MIRT734930	hsa-miR-214-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	33280526
MIRT735069	hsa-miR-27a-5p	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceqRT-PCRFlow cytometry	32790210
MIRT438781	hsa-miR-211-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	31637455
MIRT735317	hsa-miR-15b-3p	Western blottingMicroarrayqRT-PCRFlow cytometry	32355808
MIRT735442	hsa-miR-15a-3p	Western blottingqRT-PCR	32190086
MIRT735443	hsa-miR-16-1-3p	Western blottingqRT-PCR	32190086
MIRT000192	hsa-miR-204-5p	Western blottingqRT-PCR	32178301
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	31497196
MIRT001800	hsa-miR-16-5p	Luciferase reporter assayWestern blotting	31801064
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	31541355
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	31541355
MIRT736349	hsa-miR-5008-5p	Luciferase reporter assayqRT-PCR	33233721
MIRT736463	hsa-miR-23a-3p	qRT-PCRFlow cytometry	33197036
MIRT737173	hsa-miR-188-3p	Luciferase reporter assayWestern blottingqRT-PCR	33902604
MIRT737264	hsa-miR-98-3p	qRT-PCR	32647414
MIRT000290	hsa-miR-153-3p	Luciferase reporter assay	37232358
MIRT003499	hsa-miR-181c-5p	Western blottingqRT-PCR	36676955
MIRT755569	miR-153	Luciferase reporter assayWestern blottingqRT-PCR	37381058
MIRT755575	hsa-miR-625-5p	qRT-PCR	36671913
MIRT002298	hsa-miR-34a-5p	qRT-PCRFlow cytometry	34655330
MIRT755831	hsa-miR-646	Western blottingqRT-PCRin vitro cullelar assaysFlow cytometry	37155307
MIRT755892	hsa-miR-432-5p	Luciferase reporter assayWestern blottingqRT-PCR	34532813
MIRT004844	hsa-miR-192-5p	Luciferase reporter assay	36803590
MIRT756191	hsa-miR-223-3p	Western blottingqRT-PCR	38155264
MIRT756200	hsa-miR-107	Immunoprecipitaion (IP)	36816358
MIRT756243	hsa-miR-3188	Luciferase reporter assayWestern blotting	38565755
MIRT756317	hsa-miR-29b-1-5p	Western blottingImmunofluorescence	38934067
MIRT732232	hsa-miR-139-5p	Western blotting	37794118
MIRT818359	hsa-miR-1	CLIP-seq
MIRT818360	hsa-miR-1207-5p	CLIP-seq
MIRT818361	hsa-miR-1229	CLIP-seq
MIRT818362	hsa-miR-1237	CLIP-seq
MIRT818363	hsa-miR-1243	CLIP-seq
MIRT818364	hsa-miR-1246	CLIP-seq
MIRT818365	hsa-miR-1248	CLIP-seq
MIRT818366	hsa-miR-1250	CLIP-seq
MIRT818367	hsa-miR-1255a	CLIP-seq
MIRT818368	hsa-miR-1255b	CLIP-seq
MIRT818369	hsa-miR-1257	CLIP-seq
MIRT818370	hsa-miR-1261	CLIP-seq
MIRT818371	hsa-miR-1271	CLIP-seq
MIRT818372	hsa-miR-1273f	CLIP-seq
MIRT818373	hsa-miR-1275	CLIP-seq
MIRT818374	hsa-miR-1290	CLIP-seq
MIRT818375	hsa-miR-1307	CLIP-seq
MIRT818376	hsa-miR-1321	CLIP-seq
MIRT818377	hsa-miR-136	CLIP-seq
MIRT818378	hsa-miR-143	CLIP-seq
MIRT818379	hsa-miR-147	CLIP-seq
MIRT818380	hsa-miR-15a	CLIP-seq
MIRT818381	hsa-miR-15b	CLIP-seq
MIRT818382	hsa-miR-16	CLIP-seq
MIRT818383	hsa-miR-181a	CLIP-seq
MIRT818384	hsa-miR-181b	CLIP-seq
MIRT818385	hsa-miR-181c	CLIP-seq
MIRT818386	hsa-miR-181d	CLIP-seq
MIRT818387	hsa-miR-182	CLIP-seq
MIRT818388	hsa-miR-185	CLIP-seq
MIRT818389	hsa-miR-1915	CLIP-seq
MIRT818390	hsa-miR-195	CLIP-seq
MIRT818391	hsa-miR-197	CLIP-seq
MIRT818392	hsa-miR-203	CLIP-seq
MIRT818393	hsa-miR-204	CLIP-seq
MIRT818394	hsa-miR-2052	CLIP-seq
MIRT818395	hsa-miR-2053	CLIP-seq
MIRT818396	hsa-miR-211	CLIP-seq
MIRT818397	hsa-miR-219-2-3p	CLIP-seq
MIRT818398	hsa-miR-2278	CLIP-seq
MIRT818399	hsa-miR-23a	CLIP-seq
MIRT818400	hsa-miR-23b	CLIP-seq
MIRT818401	hsa-miR-23c	CLIP-seq
MIRT818402	hsa-miR-25	CLIP-seq
MIRT818403	hsa-miR-2964a-5p	CLIP-seq
MIRT818404	hsa-miR-298	CLIP-seq
MIRT818405	hsa-miR-302f	CLIP-seq
MIRT818406	hsa-miR-3064-3p	CLIP-seq
MIRT818407	hsa-miR-3074-3p	CLIP-seq
MIRT818408	hsa-miR-3120-5p	CLIP-seq
MIRT818409	hsa-miR-3121-3p	CLIP-seq
MIRT818410	hsa-miR-3123	CLIP-seq
MIRT818411	hsa-miR-3140-3p	CLIP-seq
MIRT818412	hsa-miR-3144-3p	CLIP-seq
MIRT818413	hsa-miR-3145-3p	CLIP-seq
MIRT818414	hsa-miR-3150b-3p	CLIP-seq
MIRT818415	hsa-miR-3152-5p	CLIP-seq
MIRT818416	hsa-miR-3157-5p	CLIP-seq
MIRT818417	hsa-miR-3158-3p	CLIP-seq
MIRT818418	hsa-miR-3160-3p	CLIP-seq
MIRT818419	hsa-miR-3162-3p	CLIP-seq
MIRT818420	hsa-miR-3163	CLIP-seq
MIRT818421	hsa-miR-3164	CLIP-seq
MIRT818422	hsa-miR-3167	CLIP-seq
MIRT818423	hsa-miR-3185	CLIP-seq
MIRT818424	hsa-miR-32	CLIP-seq
MIRT818425	hsa-miR-3201	CLIP-seq
MIRT818426	hsa-miR-3202	CLIP-seq
MIRT818427	hsa-miR-323b-5p	CLIP-seq
MIRT818428	hsa-miR-340	CLIP-seq
MIRT818429	hsa-miR-342-5p	CLIP-seq
MIRT818430	hsa-miR-34a	CLIP-seq
MIRT818431	hsa-miR-34c-3p	CLIP-seq
MIRT818432	hsa-miR-3545-3p	CLIP-seq
MIRT818433	hsa-miR-3612	CLIP-seq
MIRT818434	hsa-miR-3613-3p	CLIP-seq
MIRT818435	hsa-miR-361-3p	CLIP-seq
MIRT818436	hsa-miR-3614-3p	CLIP-seq
MIRT818437	hsa-miR-3622b-5p	CLIP-seq
MIRT818438	hsa-miR-363	CLIP-seq
MIRT818439	hsa-miR-365	CLIP-seq
MIRT818440	hsa-miR-3654	CLIP-seq
MIRT818441	hsa-miR-3662	CLIP-seq
MIRT818442	hsa-miR-367	CLIP-seq
MIRT818443	hsa-miR-3678-3p	CLIP-seq
MIRT818444	hsa-miR-3679-3p	CLIP-seq
MIRT818445	hsa-miR-3682-3p	CLIP-seq
MIRT818446	hsa-miR-3682-5p	CLIP-seq
MIRT818447	hsa-miR-3686	CLIP-seq
MIRT818448	hsa-miR-3689a-3p	CLIP-seq
MIRT818449	hsa-miR-3689c	CLIP-seq
MIRT818450	hsa-miR-374c	CLIP-seq
MIRT818451	hsa-miR-377	CLIP-seq
MIRT818452	hsa-miR-3914	CLIP-seq
MIRT818453	hsa-miR-3918	CLIP-seq
MIRT818454	hsa-miR-3922-5p	CLIP-seq
MIRT818455	hsa-miR-3929	CLIP-seq
MIRT818456	hsa-miR-3943	CLIP-seq
MIRT818457	hsa-miR-409-3p	CLIP-seq
MIRT818458	hsa-miR-410	CLIP-seq
MIRT818459	hsa-miR-412	CLIP-seq
MIRT818460	hsa-miR-424	CLIP-seq
MIRT818461	hsa-miR-4259	CLIP-seq
MIRT818462	hsa-miR-4262	CLIP-seq
MIRT818463	hsa-miR-4267	CLIP-seq
MIRT818464	hsa-miR-4269	CLIP-seq
MIRT818465	hsa-miR-4270	CLIP-seq
MIRT818466	hsa-miR-4275	CLIP-seq
MIRT818467	hsa-miR-4279	CLIP-seq
MIRT818468	hsa-miR-4282	CLIP-seq
MIRT818469	hsa-miR-4289	CLIP-seq
MIRT818470	hsa-miR-4306	CLIP-seq
MIRT818471	hsa-miR-4307	CLIP-seq
MIRT818472	hsa-miR-4310	CLIP-seq
MIRT818473	hsa-miR-4317	CLIP-seq
MIRT818474	hsa-miR-432	CLIP-seq
MIRT818475	hsa-miR-4325	CLIP-seq
MIRT818476	hsa-miR-4328	CLIP-seq
MIRT818477	hsa-miR-4330	CLIP-seq
MIRT818478	hsa-miR-4419b	CLIP-seq
MIRT818479	hsa-miR-4422	CLIP-seq
MIRT818480	hsa-miR-4433	CLIP-seq
MIRT818481	hsa-miR-4438	CLIP-seq
MIRT818482	hsa-miR-4441	CLIP-seq
MIRT818483	hsa-miR-4443	CLIP-seq
MIRT818484	hsa-miR-4446-5p	CLIP-seq
MIRT818485	hsa-miR-4453	CLIP-seq
MIRT818486	hsa-miR-4457	CLIP-seq
MIRT818487	hsa-miR-4460	CLIP-seq
MIRT818488	hsa-miR-4469	CLIP-seq
MIRT818489	hsa-miR-4474-5p	CLIP-seq
MIRT818490	hsa-miR-4476	CLIP-seq
MIRT818491	hsa-miR-4478	CLIP-seq
MIRT818492	hsa-miR-4487	CLIP-seq
MIRT818493	hsa-miR-449b	CLIP-seq
MIRT818494	hsa-miR-4509	CLIP-seq
MIRT818495	hsa-miR-4512	CLIP-seq
MIRT818496	hsa-miR-4524	CLIP-seq
MIRT818497	hsa-miR-4538	CLIP-seq
MIRT818498	hsa-miR-4539	CLIP-seq
MIRT818499	hsa-miR-4638-5p	CLIP-seq
MIRT818500	hsa-miR-4639-3p	CLIP-seq
MIRT818501	hsa-miR-4639-5p	CLIP-seq
MIRT818502	hsa-miR-4644	CLIP-seq
MIRT818503	hsa-miR-4652-3p	CLIP-seq
MIRT818504	hsa-miR-4664-5p	CLIP-seq
MIRT818505	hsa-miR-4665-5p	CLIP-seq
MIRT818506	hsa-miR-4684-3p	CLIP-seq
MIRT818507	hsa-miR-4685-5p	CLIP-seq
MIRT818508	hsa-miR-4691-3p	CLIP-seq
MIRT818509	hsa-miR-4694-3p	CLIP-seq
MIRT818510	hsa-miR-4699-3p	CLIP-seq
MIRT818511	hsa-miR-4708-5p	CLIP-seq
MIRT818512	hsa-miR-4709-3p	CLIP-seq
MIRT818513	hsa-miR-4711-3p	CLIP-seq
MIRT818514	hsa-miR-4720-3p	CLIP-seq
MIRT818515	hsa-miR-4727-3p	CLIP-seq
MIRT818516	hsa-miR-4731-3p	CLIP-seq
MIRT818517	hsa-miR-4736	CLIP-seq
MIRT818518	hsa-miR-4739	CLIP-seq
MIRT818519	hsa-miR-4742-3p	CLIP-seq
MIRT818520	hsa-miR-4744	CLIP-seq
MIRT818521	hsa-miR-4746-3p	CLIP-seq
MIRT818522	hsa-miR-4755-5p	CLIP-seq
MIRT818523	hsa-miR-4756-5p	CLIP-seq
MIRT818524	hsa-miR-4762-3p	CLIP-seq
MIRT818525	hsa-miR-4763-3p	CLIP-seq
MIRT818526	hsa-miR-4770	CLIP-seq
MIRT818527	hsa-miR-4775	CLIP-seq
MIRT818528	hsa-miR-4781-3p	CLIP-seq
MIRT818529	hsa-miR-4784	CLIP-seq
MIRT818530	hsa-miR-4791	CLIP-seq
MIRT818531	hsa-miR-4797-3p	CLIP-seq
MIRT818532	hsa-miR-4797-5p	CLIP-seq
MIRT818533	hsa-miR-4799-5p	CLIP-seq
MIRT818534	hsa-miR-4801	CLIP-seq
MIRT818535	hsa-miR-4804-3p	CLIP-seq
MIRT818536	hsa-miR-490-5p	CLIP-seq
MIRT818537	hsa-miR-497	CLIP-seq
MIRT818538	hsa-miR-498	CLIP-seq
MIRT818539	hsa-miR-503	CLIP-seq
MIRT818540	hsa-miR-5095	CLIP-seq
MIRT818541	hsa-miR-510	CLIP-seq
MIRT818542	hsa-miR-512-5p	CLIP-seq
MIRT818543	hsa-miR-515-5p	CLIP-seq
MIRT818544	hsa-miR-522	CLIP-seq
MIRT818545	hsa-miR-526b	CLIP-seq
MIRT818546	hsa-miR-548a-3p	CLIP-seq
MIRT818547	hsa-miR-548ac	CLIP-seq
MIRT818548	hsa-miR-548ae	CLIP-seq
MIRT818549	hsa-miR-548ag	CLIP-seq
MIRT818550	hsa-miR-548ai	CLIP-seq
MIRT818551	hsa-miR-548aj	CLIP-seq
MIRT818552	hsa-miR-548am	CLIP-seq
MIRT818553	hsa-miR-548c-3p	CLIP-seq
MIRT818554	hsa-miR-548d-3p	CLIP-seq
MIRT818555	hsa-miR-548e	CLIP-seq
MIRT818556	hsa-miR-548f	CLIP-seq
MIRT818557	hsa-miR-548t	CLIP-seq
MIRT818558	hsa-miR-548x	CLIP-seq
MIRT818559	hsa-miR-548z	CLIP-seq
MIRT818560	hsa-miR-558	CLIP-seq
MIRT818561	hsa-miR-568	CLIP-seq
MIRT818562	hsa-miR-569	CLIP-seq
MIRT818563	hsa-miR-571	CLIP-seq
MIRT818564	hsa-miR-577	CLIP-seq
MIRT818565	hsa-miR-578	CLIP-seq
MIRT818566	hsa-miR-579	CLIP-seq
MIRT818567	hsa-miR-587	CLIP-seq
MIRT818568	hsa-miR-590-3p	CLIP-seq
MIRT818569	hsa-miR-595	CLIP-seq
MIRT818570	hsa-miR-606	CLIP-seq
MIRT818571	hsa-miR-613	CLIP-seq
MIRT818572	hsa-miR-616	CLIP-seq
MIRT818573	hsa-miR-617	CLIP-seq
MIRT818574	hsa-miR-623	CLIP-seq
MIRT818575	hsa-miR-624	CLIP-seq
MIRT818576	hsa-miR-636	CLIP-seq
MIRT818577	hsa-miR-642a	CLIP-seq
MIRT818578	hsa-miR-643	CLIP-seq
MIRT755831	hsa-miR-646	CLIP-seq
MIRT818579	hsa-miR-650	CLIP-seq
MIRT818580	hsa-miR-655	CLIP-seq
MIRT818581	hsa-miR-656	CLIP-seq
MIRT818582	hsa-miR-664	CLIP-seq
MIRT818583	hsa-miR-765	CLIP-seq
MIRT818584	hsa-miR-873	CLIP-seq
MIRT818585	hsa-miR-876-5p	CLIP-seq
MIRT818586	hsa-miR-885-5p	CLIP-seq
MIRT818587	hsa-miR-889	CLIP-seq
MIRT818588	hsa-miR-92a	CLIP-seq
MIRT818589	hsa-miR-92b	CLIP-seq
MIRT818590	hsa-miR-96	CLIP-seq
MIRT1941869	hsa-miR-1178	CLIP-seq
MIRT1941870	hsa-miR-1200	CLIP-seq
MIRT1941871	hsa-miR-1234	CLIP-seq
MIRT818363	hsa-miR-1243	CLIP-seq
MIRT818364	hsa-miR-1246	CLIP-seq
MIRT818366	hsa-miR-1250	CLIP-seq
MIRT1941872	hsa-miR-1251	CLIP-seq
MIRT1941873	hsa-miR-1267	CLIP-seq
MIRT818371	hsa-miR-1271	CLIP-seq
MIRT818373	hsa-miR-1275	CLIP-seq
MIRT818374	hsa-miR-1290	CLIP-seq
MIRT1941874	hsa-miR-1305	CLIP-seq
MIRT1941875	hsa-miR-1324	CLIP-seq
MIRT1941876	hsa-miR-140-5p	CLIP-seq
MIRT1941877	hsa-miR-146b-3p	CLIP-seq
MIRT818383	hsa-miR-181a	CLIP-seq
MIRT818384	hsa-miR-181b	CLIP-seq
MIRT818385	hsa-miR-181c	CLIP-seq
MIRT818386	hsa-miR-181d	CLIP-seq
MIRT818387	hsa-miR-182	CLIP-seq
MIRT818388	hsa-miR-185	CLIP-seq
MIRT818389	hsa-miR-1915	CLIP-seq
MIRT1941878	hsa-miR-2115	CLIP-seq
MIRT1941879	hsa-miR-216a	CLIP-seq
MIRT1941880	hsa-miR-217	CLIP-seq
MIRT1941881	hsa-miR-224	CLIP-seq
MIRT818406	hsa-miR-3064-3p	CLIP-seq
MIRT1941882	hsa-miR-3121-5p	CLIP-seq
MIRT818410	hsa-miR-3123	CLIP-seq
MIRT1941883	hsa-miR-3127-5p	CLIP-seq
MIRT818413	hsa-miR-3145-3p	CLIP-seq
MIRT818417	hsa-miR-3158-3p	CLIP-seq
MIRT1941884	hsa-miR-3159	CLIP-seq
MIRT818418	hsa-miR-3160-3p	CLIP-seq
MIRT818422	hsa-miR-3167	CLIP-seq
MIRT1941885	hsa-miR-3173-5p	CLIP-seq
MIRT1941886	hsa-miR-3180-5p	CLIP-seq
MIRT1941887	hsa-miR-3194-3p	CLIP-seq
MIRT818427	hsa-miR-323b-5p	CLIP-seq
MIRT1941888	hsa-miR-326	CLIP-seq
MIRT1941889	hsa-miR-330-5p	CLIP-seq
MIRT818429	hsa-miR-342-5p	CLIP-seq
MIRT1941890	hsa-miR-3545-5p	CLIP-seq
MIRT818436	hsa-miR-3614-3p	CLIP-seq
MIRT818439	hsa-miR-365	CLIP-seq
MIRT818440	hsa-miR-3654	CLIP-seq
MIRT818441	hsa-miR-3662	CLIP-seq
MIRT1941891	hsa-miR-3667-3p	CLIP-seq
MIRT1941892	hsa-miR-3670	CLIP-seq
MIRT1941893	hsa-miR-3671	CLIP-seq
MIRT818446	hsa-miR-3682-5p	CLIP-seq
MIRT818448	hsa-miR-3689a-3p	CLIP-seq
MIRT818449	hsa-miR-3689c	CLIP-seq
MIRT818450	hsa-miR-374c	CLIP-seq
MIRT818453	hsa-miR-3918	CLIP-seq
MIRT818454	hsa-miR-3922-5p	CLIP-seq
MIRT818455	hsa-miR-3929	CLIP-seq
MIRT818457	hsa-miR-409-3p	CLIP-seq
MIRT818458	hsa-miR-410	CLIP-seq
MIRT818461	hsa-miR-4259	CLIP-seq
MIRT818462	hsa-miR-4262	CLIP-seq
MIRT818464	hsa-miR-4269	CLIP-seq
MIRT1941894	hsa-miR-4280	CLIP-seq
MIRT1941895	hsa-miR-4297	CLIP-seq
MIRT1941896	hsa-miR-4303	CLIP-seq
MIRT818470	hsa-miR-4306	CLIP-seq
MIRT818471	hsa-miR-4307	CLIP-seq
MIRT818472	hsa-miR-4310	CLIP-seq
MIRT818474	hsa-miR-432	CLIP-seq
MIRT818477	hsa-miR-4330	CLIP-seq
MIRT818478	hsa-miR-4419b	CLIP-seq
MIRT818479	hsa-miR-4422	CLIP-seq
MIRT818483	hsa-miR-4443	CLIP-seq
MIRT818484	hsa-miR-4446-5p	CLIP-seq
MIRT818487	hsa-miR-4460	CLIP-seq
MIRT1941897	hsa-miR-4467	CLIP-seq
MIRT1941898	hsa-miR-4474-3p	CLIP-seq
MIRT818489	hsa-miR-4474-5p	CLIP-seq
MIRT1941899	hsa-miR-4477a	CLIP-seq
MIRT818491	hsa-miR-4478	CLIP-seq
MIRT818492	hsa-miR-4487	CLIP-seq
MIRT818494	hsa-miR-4509	CLIP-seq
MIRT818502	hsa-miR-4644	CLIP-seq
MIRT818503	hsa-miR-4652-3p	CLIP-seq
MIRT818504	hsa-miR-4664-5p	CLIP-seq
MIRT818505	hsa-miR-4665-5p	CLIP-seq
MIRT1941900	hsa-miR-4676-5p	CLIP-seq
MIRT818507	hsa-miR-4685-5p	CLIP-seq
MIRT1941901	hsa-miR-4690-5p	CLIP-seq
MIRT818508	hsa-miR-4691-3p	CLIP-seq
MIRT818509	hsa-miR-4694-3p	CLIP-seq
MIRT818510	hsa-miR-4699-3p	CLIP-seq
MIRT1941902	hsa-miR-4704-5p	CLIP-seq
MIRT1941903	hsa-miR-4717-5p	CLIP-seq
MIRT1941904	hsa-miR-4719	CLIP-seq
MIRT818514	hsa-miR-4720-3p	CLIP-seq
MIRT1941905	hsa-miR-4725-5p	CLIP-seq
MIRT818515	hsa-miR-4727-3p	CLIP-seq
MIRT1941906	hsa-miR-4729	CLIP-seq
MIRT818516	hsa-miR-4731-3p	CLIP-seq
MIRT818521	hsa-miR-4746-3p	CLIP-seq
MIRT1941907	hsa-miR-4778-5p	CLIP-seq
MIRT1941908	hsa-miR-4786-5p	CLIP-seq
MIRT818531	hsa-miR-4797-3p	CLIP-seq
MIRT818532	hsa-miR-4797-5p	CLIP-seq
MIRT818533	hsa-miR-4799-5p	CLIP-seq
MIRT818534	hsa-miR-4801	CLIP-seq
MIRT1941909	hsa-miR-485-3p	CLIP-seq
MIRT1941910	hsa-miR-485-5p	CLIP-seq
MIRT818536	hsa-miR-490-5p	CLIP-seq
MIRT818538	hsa-miR-498	CLIP-seq
MIRT1941911	hsa-miR-504	CLIP-seq
MIRT818541	hsa-miR-510	CLIP-seq
MIRT818542	hsa-miR-512-5p	CLIP-seq
MIRT1941912	hsa-miR-514	CLIP-seq
MIRT1941913	hsa-miR-514b-3p	CLIP-seq
MIRT818543	hsa-miR-515-5p	CLIP-seq
MIRT1941914	hsa-miR-518a-5p	CLIP-seq
MIRT1941915	hsa-miR-520a-5p	CLIP-seq
MIRT818544	hsa-miR-522	CLIP-seq
MIRT1941916	hsa-miR-525-5p	CLIP-seq
MIRT1941917	hsa-miR-527	CLIP-seq
MIRT818546	hsa-miR-548a-3p	CLIP-seq
MIRT1941918	hsa-miR-548ad	CLIP-seq
MIRT818548	hsa-miR-548ae	CLIP-seq
MIRT818549	hsa-miR-548ag	CLIP-seq
MIRT818550	hsa-miR-548ai	CLIP-seq
MIRT818551	hsa-miR-548aj	CLIP-seq
MIRT818552	hsa-miR-548am	CLIP-seq
MIRT818553	hsa-miR-548c-3p	CLIP-seq
MIRT818555	hsa-miR-548e	CLIP-seq
MIRT818556	hsa-miR-548f	CLIP-seq
MIRT818558	hsa-miR-548x	CLIP-seq
MIRT1941919	hsa-miR-550b	CLIP-seq
MIRT1941920	hsa-miR-555	CLIP-seq
MIRT818560	hsa-miR-558	CLIP-seq
MIRT1941921	hsa-miR-561	CLIP-seq
MIRT818563	hsa-miR-571	CLIP-seq
MIRT1941922	hsa-miR-575	CLIP-seq
MIRT818564	hsa-miR-577	CLIP-seq
MIRT818567	hsa-miR-587	CLIP-seq
MIRT1941923	hsa-miR-607	CLIP-seq
MIRT1941924	hsa-miR-618	CLIP-seq
MIRT1941925	hsa-miR-633	CLIP-seq
MIRT818576	hsa-miR-636	CLIP-seq
MIRT1941926	hsa-miR-651	CLIP-seq
MIRT818580	hsa-miR-655	CLIP-seq
MIRT1941927	hsa-miR-660	CLIP-seq
MIRT818582	hsa-miR-664	CLIP-seq
MIRT1941928	hsa-miR-668	CLIP-seq
MIRT1941929	hsa-miR-758	CLIP-seq
MIRT1941930	hsa-miR-874	CLIP-seq
MIRT818585	hsa-miR-876-5p	CLIP-seq
MIRT818590	hsa-miR-96	CLIP-seq
MIRT1941869	hsa-miR-1178	CLIP-seq
MIRT818360	hsa-miR-1207-5p	CLIP-seq
MIRT2180722	hsa-miR-1224-3p	CLIP-seq
MIRT2180723	hsa-miR-1236	CLIP-seq
MIRT2180724	hsa-miR-1245b-3p	CLIP-seq
MIRT2180725	hsa-miR-1260	CLIP-seq
MIRT2180726	hsa-miR-1260b	CLIP-seq
MIRT818370	hsa-miR-1261	CLIP-seq
MIRT818371	hsa-miR-1271	CLIP-seq
MIRT2180727	hsa-miR-1280	CLIP-seq
MIRT2180728	hsa-miR-1285	CLIP-seq
MIRT2180729	hsa-miR-1302	CLIP-seq
MIRT1941874	hsa-miR-1305	CLIP-seq
MIRT818376	hsa-miR-1321	CLIP-seq
MIRT818380	hsa-miR-15a	CLIP-seq
MIRT818381	hsa-miR-15b	CLIP-seq
MIRT818382	hsa-miR-16	CLIP-seq
MIRT818383	hsa-miR-181a	CLIP-seq
MIRT818384	hsa-miR-181b	CLIP-seq
MIRT818385	hsa-miR-181c	CLIP-seq
MIRT818386	hsa-miR-181d	CLIP-seq
MIRT818387	hsa-miR-182	CLIP-seq
MIRT818388	hsa-miR-185	CLIP-seq
MIRT818390	hsa-miR-195	CLIP-seq
MIRT2180730	hsa-miR-1972	CLIP-seq
MIRT2180731	hsa-miR-200b	CLIP-seq
MIRT2180732	hsa-miR-200c	CLIP-seq
MIRT818392	hsa-miR-203	CLIP-seq
MIRT818393	hsa-miR-204	CLIP-seq
MIRT818395	hsa-miR-2053	CLIP-seq
MIRT818396	hsa-miR-211	CLIP-seq
MIRT2180733	hsa-miR-2355-5p	CLIP-seq
MIRT818399	hsa-miR-23a	CLIP-seq
MIRT818400	hsa-miR-23b	CLIP-seq
MIRT818401	hsa-miR-23c	CLIP-seq
MIRT2180734	hsa-miR-30a	CLIP-seq
MIRT2180735	hsa-miR-30b	CLIP-seq
MIRT2180736	hsa-miR-30c	CLIP-seq
MIRT2180737	hsa-miR-30d	CLIP-seq
MIRT2180738	hsa-miR-30e	CLIP-seq
MIRT818409	hsa-miR-3121-3p	CLIP-seq
MIRT1941882	hsa-miR-3121-5p	CLIP-seq
MIRT1941883	hsa-miR-3127-5p	CLIP-seq
MIRT818411	hsa-miR-3140-3p	CLIP-seq
MIRT818413	hsa-miR-3145-3p	CLIP-seq
MIRT818417	hsa-miR-3158-3p	CLIP-seq
MIRT818418	hsa-miR-3160-3p	CLIP-seq
MIRT818420	hsa-miR-3163	CLIP-seq
MIRT2180739	hsa-miR-3177-5p	CLIP-seq
MIRT818423	hsa-miR-3185	CLIP-seq
MIRT2180740	hsa-miR-3187-5p	CLIP-seq
MIRT818425	hsa-miR-3201	CLIP-seq
MIRT2180741	hsa-miR-320e	CLIP-seq
MIRT2180742	hsa-miR-323-3p	CLIP-seq
MIRT818430	hsa-miR-34a	CLIP-seq
MIRT818433	hsa-miR-3612	CLIP-seq
MIRT818437	hsa-miR-3622b-5p	CLIP-seq
MIRT818441	hsa-miR-3662	CLIP-seq
MIRT1941893	hsa-miR-3671	CLIP-seq
MIRT818446	hsa-miR-3682-5p	CLIP-seq
MIRT2180743	hsa-miR-3689d	CLIP-seq
MIRT2180744	hsa-miR-3690	CLIP-seq
MIRT818450	hsa-miR-374c	CLIP-seq
MIRT2180745	hsa-miR-380	CLIP-seq
MIRT2180746	hsa-miR-383	CLIP-seq
MIRT818453	hsa-miR-3918	CLIP-seq
MIRT818456	hsa-miR-3943	CLIP-seq
MIRT2180747	hsa-miR-3944-5p	CLIP-seq
MIRT818457	hsa-miR-409-3p	CLIP-seq
MIRT818458	hsa-miR-410	CLIP-seq
MIRT818460	hsa-miR-424	CLIP-seq
MIRT2180748	hsa-miR-4254	CLIP-seq
MIRT818462	hsa-miR-4262	CLIP-seq
MIRT818465	hsa-miR-4270	CLIP-seq
MIRT2180749	hsa-miR-4277	CLIP-seq
MIRT1941894	hsa-miR-4280	CLIP-seq
MIRT2180750	hsa-miR-4298	CLIP-seq
MIRT2180751	hsa-miR-4305	CLIP-seq
MIRT818470	hsa-miR-4306	CLIP-seq
MIRT818471	hsa-miR-4307	CLIP-seq
MIRT818474	hsa-miR-432	CLIP-seq
MIRT818479	hsa-miR-4422	CLIP-seq
MIRT818482	hsa-miR-4441	CLIP-seq
MIRT818483	hsa-miR-4443	CLIP-seq
MIRT818484	hsa-miR-4446-5p	CLIP-seq
MIRT818485	hsa-miR-4453	CLIP-seq
MIRT818488	hsa-miR-4469	CLIP-seq
MIRT1941899	hsa-miR-4477a	CLIP-seq
MIRT818492	hsa-miR-4487	CLIP-seq
MIRT2180752	hsa-miR-4495	CLIP-seq
MIRT818493	hsa-miR-449b	CLIP-seq
MIRT2180753	hsa-miR-4505	CLIP-seq
MIRT818494	hsa-miR-4509	CLIP-seq
MIRT2180754	hsa-miR-4514	CLIP-seq
MIRT818496	hsa-miR-4524	CLIP-seq
MIRT818497	hsa-miR-4538	CLIP-seq
MIRT818498	hsa-miR-4539	CLIP-seq
MIRT818502	hsa-miR-4644	CLIP-seq
MIRT2180755	hsa-miR-4650-5p	CLIP-seq
MIRT2180756	hsa-miR-4666-5p	CLIP-seq
MIRT818508	hsa-miR-4691-3p	CLIP-seq
MIRT2180757	hsa-miR-4692	CLIP-seq
MIRT818509	hsa-miR-4694-3p	CLIP-seq
MIRT818510	hsa-miR-4699-3p	CLIP-seq
MIRT818512	hsa-miR-4709-3p	CLIP-seq
MIRT1941903	hsa-miR-4717-5p	CLIP-seq
MIRT1941904	hsa-miR-4719	CLIP-seq
MIRT818514	hsa-miR-4720-3p	CLIP-seq
MIRT818516	hsa-miR-4731-3p	CLIP-seq
MIRT2180758	hsa-miR-4734	CLIP-seq
MIRT818517	hsa-miR-4736	CLIP-seq
MIRT818518	hsa-miR-4739	CLIP-seq
MIRT818520	hsa-miR-4744	CLIP-seq
MIRT2180759	hsa-miR-4753-5p	CLIP-seq
MIRT2180760	hsa-miR-4754	CLIP-seq
MIRT818522	hsa-miR-4755-5p	CLIP-seq
MIRT818523	hsa-miR-4756-5p	CLIP-seq
MIRT818525	hsa-miR-4763-3p	CLIP-seq
MIRT2180761	hsa-miR-4772-5p	CLIP-seq
MIRT2180762	hsa-miR-4778-3p	CLIP-seq
MIRT1941907	hsa-miR-4778-5p	CLIP-seq
MIRT2180763	hsa-miR-4789-5p	CLIP-seq
MIRT818530	hsa-miR-4791	CLIP-seq
MIRT818532	hsa-miR-4797-5p	CLIP-seq
MIRT818533	hsa-miR-4799-5p	CLIP-seq
MIRT818534	hsa-miR-4801	CLIP-seq
MIRT1941910	hsa-miR-485-5p	CLIP-seq
MIRT818537	hsa-miR-497	CLIP-seq
MIRT818539	hsa-miR-503	CLIP-seq
MIRT818541	hsa-miR-510	CLIP-seq
MIRT818542	hsa-miR-512-5p	CLIP-seq
MIRT1941912	hsa-miR-514	CLIP-seq
MIRT1941913	hsa-miR-514b-3p	CLIP-seq
MIRT1941914	hsa-miR-518a-5p	CLIP-seq
MIRT2180764	hsa-miR-519a	CLIP-seq
MIRT2180765	hsa-miR-519b-3p	CLIP-seq
MIRT2180766	hsa-miR-519c-3p	CLIP-seq
MIRT818544	hsa-miR-522	CLIP-seq
MIRT1941917	hsa-miR-527	CLIP-seq
MIRT2180767	hsa-miR-532-3p	CLIP-seq
MIRT2180768	hsa-miR-548aa	CLIP-seq
MIRT818549	hsa-miR-548ag	CLIP-seq
MIRT818550	hsa-miR-548ai	CLIP-seq
MIRT818560	hsa-miR-558	CLIP-seq
MIRT818562	hsa-miR-569	CLIP-seq
MIRT818564	hsa-miR-577	CLIP-seq
MIRT2180769	hsa-miR-582-5p	CLIP-seq
MIRT818567	hsa-miR-587	CLIP-seq
MIRT1941923	hsa-miR-607	CLIP-seq
MIRT2180770	hsa-miR-612	CLIP-seq
MIRT818573	hsa-miR-617	CLIP-seq
MIRT818574	hsa-miR-623	CLIP-seq
MIRT1941925	hsa-miR-633	CLIP-seq
MIRT818577	hsa-miR-642a	CLIP-seq
MIRT755831	hsa-miR-646	CLIP-seq
MIRT818579	hsa-miR-650	CLIP-seq
MIRT818580	hsa-miR-655	CLIP-seq
MIRT2180771	hsa-miR-657	CLIP-seq
MIRT818582	hsa-miR-664	CLIP-seq
MIRT818583	hsa-miR-765	CLIP-seq
MIRT818587	hsa-miR-889	CLIP-seq
MIRT2180772	hsa-miR-940	CLIP-seq
MIRT818590	hsa-miR-96	CLIP-seq
MIRT818369	hsa-miR-1257	CLIP-seq
MIRT2180751	hsa-miR-4305	CLIP-seq
MIRT2384753	hsa-miR-486-3p	CLIP-seq
MIRT2444733	hsa-miR-125b	CLIP-seq
MIRT2444734	hsa-miR-3120-3p	CLIP-seq
MIRT2444735	hsa-miR-3714	CLIP-seq
MIRT2444736	hsa-miR-4319	CLIP-seq
MIRT2444737	hsa-miR-4668-3p	CLIP-seq
MIRT2444738	hsa-miR-4732-3p	CLIP-seq
MIRT2444739	hsa-miR-4766-5p	CLIP-seq
MIRT2444740	hsa-miR-545	CLIP-seq
MIRT2444741	hsa-miR-548an	CLIP-seq
MIRT818553	hsa-miR-548c-3p	CLIP-seq
MIRT2444742	hsa-miR-548p	CLIP-seq
MIRT2444743	hsa-miR-605	CLIP-seq
MIRT2444744	hsa-miR-670	CLIP-seq

Show/Hide all (62)

Transcription factor	Regulation	Reference
ABL1	Repression	11753601
ATF1	Unknown	10542244
ATF5	Activation	21212266
ATM	Repression	16214353
BACH2	Unknown	18929412
CEBPA	Repression	12970736
CREB1	Activation	17290286
CREB1	Unknown	10542244;19626458
DDB2	Repression	20013802
DEK	Activation	17685435
E2F1	Activation	11559537;12679318
ERCC2	Repression	22387547
ESR1	Activation	19148464
ESR1	Unknown	10542244;11261829;9306964
FOXA1	Repression	19127412
GLI1	Activation	19074837;21135115
GLI1	Repression	14555646
GLI1	Unknown	15520176;24739390
GLI2	Activation	16880536;21135115
HOXA1	Activation	12482855;15665309
ING2	Repression	15748897
ING4	Repression	19895734;20707719
IRF1	Repression	10918594
MSX2	Repression	21730974
MYB	Activation	11675351
MYB	Repression	20659323
MYB	Unknown	16088151
MYC	Unknown	18809243
NCOA3	Activation	22213475
NFKB1	Activation	14978135;18158998;19259124;20446017;21503108
NFKB1	Repression	12032828;15120608;18031796;18566231
NFKB1	Unknown	14739605;16022909;16453001;17673602;18761399;19233129;20103608;20332461
NR1I2	Activation	16085054
PARP1	Repression	20564216
PAWR	Repression	11912153;9989812
PAX5	Repression	22105368
PER1	Activation	19675098
PGR	Activation	17785366
PGR	Unknown	9306964
PPARG	Activation	15067355
PPARG	Repression	14960510
RELA	Activation	14978135;18158998;19259124;20446017;21503108
RELA	Repression	15120608;18031796;18566231
RELA	Unknown	14739605;16022909;16453001;17673602;18761399;19233129;20103608;20332461
SATB1	Activation	20564216
SATB1	Unknown	21310710
SIM2	Repression	21729534
SMAD2	Unknown	24739390
SMAD4	Unknown	24739390
SP1	Unknown	10542244
STAT3	Activation	15184887;15805299;18839277;19926637;21435102;22504301
STAT3	Repression	22313388
STAT3	Unknown	18320073;20043094;20446017;21172343;21344490;21385902
TBP	Repression	11313951
TCF4	Unknown	23671559
TFAP2A	Repression	16533807
TP53	Repression	11313951;17693666;19411072;20428827;9000137
TP53	Unknown	21859835
TWIST1	Unknown	23095743
WT1	Unknown	12644474
ZBTB16	Repression	14769944
ZNRD1	Activation	16373708;16609701

228

Show/Hide all (228)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	16717086
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001503	Process	Ossification	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001776	Process	Leukocyte homeostasis	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	ISS	9843949
GO:0001836	Process	Release of cytochrome c from mitochondria	NAS	9027314
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0002020	Function	Protease binding	IDA	10620603
GO:0002260	Process	Lymphocyte homeostasis	IEA
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0002326	Process	B cell lineage commitment	IEA
GO:0002360	Process	T cell lineage commitment	IEA
GO:0002520	Process	Immune system development	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003014	Process	Renal system process	IEA
GO:0005515	Function	Protein binding	IPI	7954800, 9305631, 9334338, 9388232, 9463381, 9660918, 9973195, 10837489, 11054413, 11060313, 11126360, 11278245, 11463391, 12624108, 12667443, 12901880, 14739602, 15694340, 15733859, 16697956, 16790527, 17074758, 17289999, 17418785, 17428862, 17446862, 17525735, 17692808, 18719108, 1
GO:0005634	Component	Nucleus	IDA	7546744, 7896880
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	7546744, 11530860
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	7896880, 9027314
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	21358617
GO:0005741	Component	Mitochondrial outer membrane	IDA	8402648, 9027314
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	8402648
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	21358617
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006582	Process	Melanin metabolic process	IEA
GO:0006808	Process	Regulation of nitrogen utilization	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IDA	36599, 8022822
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006959	Process	Humoral immune response	TAS	1908951
GO:0006974	Process	DNA damage response	IMP	17875758
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007565	Process	Female pregnancy	NAS	11530860
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	28280358
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	10597216
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009314	Process	Response to radiation	NAS	15799693
GO:0009410	Process	Response to xenobiotic stimulus	IDA	36599
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IMP	17875758
GO:0009636	Process	Response to toxic substance	IDA	16717086
GO:0009636	Process	Response to toxic substance	IDA	16307838
GO:0009636	Process	Response to toxic substance	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010039	Process	Response to iron ion	IDA	11264898
GO:0010224	Process	Response to UV-B	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	21358617
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	TAS	18309324
GO:0010523	Process	Negative regulation of calcium ion transport into cytosol	IEA
GO:0010559	Process	Regulation of glycoprotein biosynthetic process	IEA
GO:0014031	Process	Mesenchymal cell development	IEA
GO:0014042	Process	Positive regulation of neuron maturation	IEA
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0015267	Function	Channel activity	IBA
GO:0015267	Function	Channel activity	IDA	9219694
GO:0016020	Component	Membrane	IDA	7896880
GO:0016020	Component	Membrane	IEA
GO:0016248	Function	Channel inhibitor activity	IDA	9219694
GO:0016477	Process	Cell migration	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0021747	Process	Cochlear nucleus development	IEA
GO:0022612	Process	Gland morphogenesis	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030307	Process	Positive regulation of cell growth	IDA	8022822
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030318	Process	Melanocyte differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	17875758
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20889974
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031965	Component	Nuclear membrane	IDA	1502141, 8402648
GO:0031965	Component	Nuclear membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	TAS	18309324
GO:0032835	Process	Glomerulus development	IEA
GO:0032848	Process	Negative regulation of cellular pH reduction	IDA	10506221
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032991	Component	Protein-containing complex	IMP	15733859
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033687	Process	Osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0034097	Process	Response to cytokine	IDA	9184696
GO:0034097	Process	Response to cytokine	IEA
GO:0035094	Process	Response to nicotine	IDA	12421819
GO:0035265	Process	Organ growth	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042100	Process	B cell proliferation	IDA	1373874
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042802	Function	Identical protein binding	IPI	9111042, 9463381, 18835031
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	NAS	14634621
GO:0043066	Process	Negative regulation of apoptotic process	IDA	1373874, 7650367, 7772249, 8050499, 8080725, 15776018
GO:0043066	Process	Negative regulation of apoptotic process	IDA	9027314, 9219694, 10506221, 10620603, 20041405
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IGI	9660918, 28280358
GO:0043066	Process	Negative regulation of apoptotic process	IMP	7772249
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17289999, 21212266
GO:0043067	Process	Regulation of programmed cell death	IEA
GO:0043209	Component	Myelin sheath	IEA
GO:0043375	Process	CD8-positive, alpha-beta T cell lineage commitment	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	7546744
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	12086670
GO:0043583	Process	Ear development	IEA
GO:0045069	Process	Regulation of viral genome replication	IEA
GO:0045636	Process	Positive regulation of melanocyte differentiation	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0046666	Process	Retinal cell programmed cell death	IEA
GO:0046671	Process	Negative regulation of retinal cell programmed cell death	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS	9843949
GO:0046930	Component	Pore complex	IDA	9219694
GO:0046982	Function	Protein heterodimerization activity	IPI	9111042
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048066	Process	Developmental pigmentation	IEA
GO:0048070	Process	Regulation of developmental pigmentation	IEA
GO:0048087	Process	Positive regulation of developmental pigmentation	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048599	Process	Oocyte development	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0048743	Process	Positive regulation of skeletal muscle fiber development	IEA
GO:0048753	Process	Pigment granule organization	IEA
GO:0048864	Process	Stem cell development	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	17875758
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	TAS	16167175
GO:0051434	Function	BH3 domain binding	IPI	9111042
GO:0051607	Process	Defense response to virus	IDA	10620603
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	ISS	9843949
GO:0051902	Process	Negative regulation of mitochondrial depolarization	TAS	9027314
GO:0051924	Process	Regulation of calcium ion transport	IDA	8022822
GO:0060090	Function	Molecular adaptor activity	EXP	26858413
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060402	Process	Calcium ion transport into cytosol	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	15776018
GO:0070227	Process	Lymphocyte apoptotic process	IEA
GO:0070229	Process	Negative regulation of lymphocyte apoptotic process	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097048	Process	Dendritic cell apoptotic process	IEA
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097136	Component	Bcl-2 family protein complex	IEA
GO:0097138	Component	BAD-BCL-2 complex	IPI	9463381
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16443602
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	TAS	1286168
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IEA
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356
GO:2001233	Process	Regulation of apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IMP	20097879
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IGI	8358790
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IDA	11684014

MIM	HGNC	e!Ensembl
151430	990	ENSG00000171791

P10415

Protein name

Apoptosis regulator Bcl-2

Protein function

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells (PubMed:1508712, PubMed:8183370). Regulates cell death by controlling the mitochondrial membrane permeability (PubMed:11368354). Ap

PDB

1G5M , 1GJH , 1YSW , 2O21 , 2O22 , 2O2F , 2W3L , 2XA0 , 4AQ3 , 4IEH , 4LVT , 4LXD , 4MAN , 5AGW , 5AGX , 5FCG , 5JSN , 5VAU , 5VAX , 5VAY , 6GL8 , 6IWB , 6O0K , 6O0L , 6O0M , 6O0O , 6O0P , 7LHB , 7Y90 , 7YA5 , 8FY1 , 8FY2 , 8HLL , 8HLM , 8HLN , 8HOG , 8HOH , 8HOI , 8HTR , 8HTS , 8IQL , 8U27 , 8VWX , 8VWZ , 8VXM , 8VXN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02180	BH4	8 → 32	Bcl-2 homology region 4	Family
PF00452	Bcl-2	97 → 195	Apoptosis regulator proteins, Bcl-2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues.

Sequence

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Sequence length

239

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
BCL2-related disorder	Benign	rs61733416, rs1801018	RCV003917301 RCV003977258

Show/Hide Text Mining Associations (739)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Associate	28865602
Abortion Habitual	Stimulate	39941094
Abortion Spontaneous	Associate	30937706
Abortion Spontaneous	Inhibit	39408839
Achalasia Addisonianism Alacrimia syndrome	Associate	26892631, 26931436, 29785017, 29903764, 30210134, 31171907, 31288832, 31315646, 31518494, 32311849, 33168821, 33768318, 34289655, 34698437, 36823603
Achondroplasia	Associate	12929929
Acquired Immunodeficiency Syndrome	Associate	11861282, 7605982, 8644847, 9680371
Acute Aortic Syndrome	Associate	33953793
Acute erythroleukemia	Associate	24451410
Acute erythroleukemia	Stimulate	31253168
Acute Kidney Injury	Associate	12118096, 22710204
Acute Lung Injury	Associate	36555290
Adenocarcinoma	Associate	11500787, 14692814, 14716828, 15379952, 15700269, 17354623, 19331225, 21978692, 24387269, 25066397, 25926247, 27520705, 31063013, 36357817, 7856728 View all (5 more)
Adenocarcinoma	Stimulate	15484295, 19050681
Adenocarcinoma	Inhibit	20604962
Adenocarcinoma Follicular	Associate	26422859
Adenocarcinoma Mucinous	Stimulate	11349216
Adenocarcinoma Mucinous	Associate	36916704
Adenocarcinoma of Lung	Associate	17989874, 23991130, 25066397, 26366732, 27356570, 28618418, 29247949, 30815935, 31432162, 34644678, 35399076, 35473552, 38182570, 39346927, 8774138
Adenoma	Stimulate	10607921, 11349216
Adenoma	Associate	10780525, 10944610, 11194193, 15188026, 15303767, 16219172, 16295777, 34762658, 9293892, 9610615
Adenoma	Inhibit	8611422
Adenoma Oxyphilic	Associate	11786411, 8943742
Adenoma Pleomorphic	Associate	24740354, 25230790
Adenomatous Polyposis Coli	Associate	15509520
Adenomatous Polyps	Associate	17278192
Adenomyosis	Associate	16019350, 17296180
Adjustment Disorders	Associate	15669024
Age Related Hearing Impairment 1	Associate	27555755
Aggressive Periodontitis	Associate	16787530
AIDS related Kaposi sarcoma	Associate	10662620
AIDS related Kaposi sarcoma	Stimulate	8644847
Alzheimer Disease	Associate	29422088, 29851783
Alzheimer Disease	Inhibit	8922409
Ameloblastoma	Associate	22207432, 22395508, 25866434
Amyotrophic Lateral Sclerosis	Associate	33972534, 37612427
Androgen Insensitivity Syndrome	Associate	20589722
Anemia	Associate	16799206
Anemia Aplastic	Associate	11380462, 9580207
Anemia Aplastic	Inhibit	33586472
Anemia Refractory	Associate	12111784, 1536952
Anemia Refractory with Excess of Blasts	Associate	11090080, 1536952
Aneuploidy	Associate	8854645
Anodontia	Stimulate	16042757
Antiphospholipid Syndrome	Associate	19423430
Aortic Aneurysm Thoracic	Associate	34265237
Aphasia Broca	Associate	32780847
Apical Hypertrophic Cardiomyopathy	Associate	37567042
Appendiceal Neoplasms	Inhibit	12088454
Arrhythmogenic Right Ventricular Dysplasia	Associate	33399099
Arthritis Psoriatic	Associate	7747803
Arthritis Rheumatoid	Inhibit	10403282
Arthritis Rheumatoid	Associate	14691302, 17328050, 23421940, 24920239, 30352835, 32584515, 33087158, 35904110, 8774162, 9022077
Asthma	Associate	10704078, 10770817, 11866006, 17463414, 19610265, 23314903, 24152222, 24641294
Astrocytoma	Associate	11175638, 16688362, 16875495, 18327814, 18670645, 21468591, 35977048, 9060818
Ataxia Telangiectasia	Associate	10555759, 10606975, 11133771, 37363966
Atelosteogenesis type 2	Associate	34425224
Atherosclerosis	Associate	27460740
Atrial Fibrillation	Inhibit	16043935
Atrial Fibrillation	Associate	27141955, 34957910
Atrophy	Associate	15492912
Atypical Hemolytic Uremic Syndrome	Inhibit	23805250
Autism Spectrum Disorder	Associate	32245323
Autistic Disorder	Associate	20375269
Autoimmune Diseases	Associate	10209518
Autoimmune Lymphoproliferative Syndrome	Associate	25174872
Barrett Esophagus	Associate	15563666, 20604962
Basal Ganglia Hemorrhage	Associate	28682428
Basaloid Follicular Hamartoma Syndrome Generalized Autosomal Dominant	Stimulate	9865831
Behcet Syndrome	Stimulate	10704147
Behcet Syndrome	Associate	15986355
Bicuspid Aortic Valve Disease	Associate	18179910, 37108591
Bile Duct Diseases	Associate	23497522
Biliary Tract Neoplasms	Associate	14606101
Binge Drinking	Inhibit	12603597
Bipolar Disorder	Associate	21167476, 23072837, 25726893
Blast Crisis	Associate	18534064, 22033489, 23333150, 33836616
Blast Injuries	Associate	28323898
Blindness	Stimulate	15510606
Blood Platelet Disorders	Associate	21562047
Bone Marrow Diseases	Associate	10072109, 12937123
Brain Diseases	Associate	22198673
Brain Edema	Associate	32515262
Brain Injuries Diffuse	Associate	9327733
Brain Injuries Traumatic	Associate	20504155, 32515262
Brain Ischemia	Associate	30539420
Brain Neoplasms	Associate	18338171, 26163602, 29110584, 37423059, 37586773
Breast Carcinoma In Situ	Associate	24023670
Breast Diseases	Associate	15467428, 7915536
Breast Neoplasms	Associate	10399627, 10496350, 10507761, 10542244, 10733592, 10918285, 10998426, 11025483, 11044356, 11153146, 11275791, 11323501, 11489892, 12210599, 12429812 View all (175 more)
Breast Neoplasms	Inhibit	34360714
Breast Neoplasms	Stimulate	39732179
Breast Neoplasms Male	Associate	23573235
Bronchiolitis Obliterans Syndrome	Associate	21900196, 32247860
Burkitt Lymphoma	Inhibit	11389007
Burkitt Lymphoma	Associate	1378321, 19018532, 19363496, 20118770, 22241218, 25612555, 26218299, 26763367, 31127617, 35077634, 35794096, 38468555
Cakut	Associate	34502088
Calcifying Epithelial Odontogenic Tumor	Associate	29476674
Calcinosis Cutis	Associate	12669250, 7734290
Cap Myopathy	Associate	16827116
Carcinogenesis	Associate	10362119, 10607921, 10794603, 11044356, 11194193, 11349216, 12941126, 15467428, 15858118, 15976908, 16475721, 16875495, 17632454, 17694953, 17989874 View all (22 more)
Carcinoid Tumor	Associate	18172265, 30941978
Carcinoid Tumor	Inhibit	26008974
Carcinoma	Associate	17431014, 24718460, 31977320, 7734290, 7856728, 8546897, 9804855
Carcinoma	Inhibit	19683979
Carcinoma Adenoid Cystic	Stimulate	21552290
Carcinoma Adenoid Cystic	Associate	29328455
Carcinoma Basal Cell	Associate	12575847, 14669293, 21424069, 23599161, 26429176, 35636508, 36253891, 7747803
Carcinoma Basal Cell	Stimulate	24322021, 9865831
Carcinoma Ductal	Associate	10793072, 11173657, 11994759, 15467428, 22420628, 26464626, 30583683
Carcinoma Ductal Breast	Associate	16839413, 17372162, 36510982
Carcinoma Endometrioid	Stimulate	12060448
Carcinoma Endometrioid	Associate	16619475, 33416213
Carcinoma Giant Cell	Associate	21706237
Carcinoma Giant Cell	Stimulate	31655833
Carcinoma Hepatocellular	Associate	10567879, 11749866, 11854904, 12439925, 15052673, 16627984, 18023099, 18203291, 19360919, 19447220, 20647330, 21040406, 21771706, 21829603, 22292626 View all (53 more)
Carcinoma in Situ	Associate	15467428, 21956856
Carcinoma Intraductal Noninfiltrating	Associate	11173657, 21139586
Carcinoma Large Cell	Associate	38086335, 8952529
Carcinoma Lobular	Associate	11153146
Carcinoma Medullary	Associate	8546897
Carcinoma Merkel Cell	Associate	19307957, 22814318, 34896889
Carcinoma Mucoepidermoid	Associate	21804218, 22828373, 24256941
Carcinoma Neuroendocrine	Stimulate	22251937
Carcinoma Neuroendocrine	Associate	8774138, 9052408
Carcinoma Non Small Cell Lung	Associate	10070896, 10070903, 10487853, 10938137, 11401061, 12421819, 12824911, 12833466, 15073856, 15173860, 15274378, 15700269, 15753661, 17449943, 17848143 View all (47 more)
Carcinoma Ovarian Epithelial	Associate	10666369, 12445249, 17465257, 20082279, 30178832, 30178833
Carcinoma Pancreatic Ductal	Associate	22024503, 22384141, 25120759, 25184537, 26606261, 37477952, 37700464
Carcinoma Papillary	Associate	16123814, 26429174
Carcinoma Renal Cell	Associate	12941126, 14710230, 17541305, 19305426, 20208132, 24236538, 24743574, 26821530, 29899382, 31081053, 31259714, 32009115, 33022894, 33932757, 34490473 View all (6 more)
Carcinoma Signet Ring Cell	Stimulate	8440743
Carcinoma Small Cell	Associate	12657131, 7977636, 8774138, 8938949
Carcinoma Small Cell	Inhibit	20004174
Carcinoma Squamous Cell	Associate	10514383, 10646898, 17694953, 20631638, 21068757, 22124045, 24322021, 24774218, 25084400, 26960457, 27356570, 28679648, 32188965, 35024732, 39333222, 8393963, 8763257, 8774138 View all (3 more)
Carcinoma Squamous Cell	Inhibit	17632454, 25593302
Carcinoma Transitional Cell	Associate	15448751, 28417194, 8707954
Carcinoma Verrucous	Associate	27509922
Carcinosarcoma	Associate	28193280
Cardiomyopathies	Associate	12907417
Cardiomyopathy Dilated	Associate	23497522
Cardiomyopathy Hypertrophic	Stimulate	16405608
Cataract Age Related Nuclear	Associate	30569090
Celiac Disease	Associate	23991739
Cell Transformation Neoplastic	Associate	18715689, 31173474
Cell Transformation Viral	Associate	12111784
Central Nervous System Diseases	Associate	18556402, 26834242
Central Nervous System Neoplasms	Associate	12391455
Cheilitis glandularis	Associate	24387269, 9208811
Chemical and Drug Induced Liver Injury	Associate	10209518, 16423888, 31838216
Chemotherapy Related Cognitive Impairment	Associate	23908177
Cherubism	Associate	21706237
Chickenpox	Inhibit	8340752
Cholangiocarcinoma	Associate	15484294, 28652654, 33962620, 35307646, 35790790, 8129031
Chondrosarcoma	Associate	11140704, 15685701, 19445670, 20127255, 22112972, 23415961, 34070455
Chondrosarcoma	Stimulate	17343283
Chondrosarcoma Mesenchymal	Associate	27617402, 40301759
Choriocarcinoma	Associate	23065465
Choroideremia	Associate	37216303
Chromosome 12 12p trisomy	Associate	22686190
Chromosome 14 trisomy	Associate	10354143, 11572760, 23263985
Chromosome Aberrations	Associate	20348878, 20699221
Chromosome Disorders	Associate	12930384
Chromosome Fragility	Associate	20880994
Chronic Periodontitis	Associate	24025186
Cicatrix	Associate	16029273
Cleft Palate	Associate	24025186
Cognitive Dysfunction	Associate	33447019
Coinfection	Associate	11167830
Colitis Associated Neoplasms	Associate	8909260
Colitis Ulcerative	Associate	23599650, 31159239, 39252247
Colonic Neoplasms	Associate	15955446, 16186958, 16773715, 17192048, 18071066, 20721457, 28714374, 31040202, 8063611, 9020491
Colonic Polyps	Stimulate	7856728
Colorectal Neoplasms	Associate	10193519, 11237386, 11349216, 12033956, 12149448, 12670866, 15314290, 15627889, 15955446, 16127422, 16308474, 16358373, 16830272, 17192048, 17278192 View all (82 more)
Common Variable Immunodeficiency	Associate	10844530, 11472434, 30464201
Common Variable Immunodeficiency	Inhibit	32961586
Complement Component 6 Deficiency	Associate	23907460
Congenital contractural arachnodactyly	Associate	35983950
Continuous Muscle Fiber Activity Hereditary	Associate	11570908
Corneal dystrophy Avellino type	Associate	19497990
Coronary Artery Disease	Associate	26823859
COVID 19	Associate	34076792, 35066575, 35321977
Crohn Disease	Associate	31159239
Cross Infection	Associate	27015534
Cryoglobulinemia	Associate	11877309
Cryoglobulinemia Familial Mixed	Associate	11023531
Crystal Arthropathies	Associate	36982526
Cushing Syndrome	Stimulate	36555435
Cystic Fibrosis	Associate	19201925
Cysts	Associate	12372462, 20210794, 24127964
Cytochrome c Oxidase Deficiency	Inhibit	33245769
Cytokine Release Syndrome	Associate	15755285
De Lange Syndrome	Associate	29088292
Death	Associate	10754513, 12036455, 14726400, 15308849, 17372162, 17431014, 17449943, 18670645, 19010820, 19196738, 21063403, 21704149, 21782324, 23908177, 24506200 View all (6 more)
Depressive Disorder	Inhibit	16098144
Depressive Disorder	Associate	20010695, 25726893
Dermatitis Atopic	Associate	11091268, 12605696
Dermatitis Atopic 1	Associate	11207646
Dermatitis Herpetiformis	Stimulate	16388717
Dermatitis Phototoxic	Associate	10416606, 20374575
Dermatomyositis	Associate	16850099
Diabetes Mellitus	Associate	16388709, 20200776, 21521253, 22828168, 26782377, 31615341, 33490239, 34512554
Diabetes Mellitus	Inhibit	27141571
Diabetes Mellitus Type 1	Associate	16388709, 39464889
Diabetes Mellitus Type 2	Associate	20200776, 30593206, 38027164
Diabetic Foot	Associate	34293021
Diabetic Nephropathies	Associate	16388709
Diabetic Neuropathies	Associate	40214234
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	16254104, 26960459
Diffuse panbronchiolitis	Associate	16574390
DiGeorge Syndrome	Associate	9697985
Disease	Associate	15982342, 17503433, 31808877
Disease Progression	Associate	34861696, 37955424
Dissection Ascending Aorta	Associate	22978789
DNA Virus Infections	Associate	21068357
Down Syndrome	Associate	25222269
Drug Hypersensitivity	Associate	12403774, 31736281
Drug Related Side Effects and Adverse Reactions	Stimulate	10848789
Drug Related Side Effects and Adverse Reactions	Associate	11046153, 11355954, 15908782, 16450387, 19821820, 21135115, 21159604, 21880146, 21934653, 23568006, 23862748, 24014050, 25301444, 26265185, 26474854 View all (16 more)
Drug Related Side Effects and Adverse Reactions	Inhibit	23072837, 28103869, 31995555, 32862611, 34360714
Drug Resistant Epilepsy	Associate	16627975, 24669930, 36606708
Dysentery Bacillary	Associate	12011015
Dyspareunia	Associate	40243611
Dysplastic Nevus Syndrome	Associate	11194193, 16533178, 7856728
Edema	Associate	32515262
Emanuel syndrome	Associate	18422996, 33649772, 34639102, 35171994, 37729611
Emanuel syndrome	Stimulate	33901326
Empyema Pleural	Associate	11322168
Encephalitis	Associate	31353670
Endocrine System Diseases	Associate	21622563
Endometrial Hyperplasia	Associate	40256590
Endometrial Neoplasms	Associate	12237915, 16123814, 16250278, 16619475, 18398703, 19846939, 20686376, 21888833, 22032837, 22252757, 23167388, 23637776, 28421904, 29264761, 29560769 View all (9 more)
Endometriosis	Associate	11020520, 19501353, 24127964, 26743275, 33817715, 34746304, 40243611
Enterocolitis Necrotizing	Associate	27164337
Enterocolitis Neutropenic	Stimulate	12911946
Eosinophilia	Associate	34654952
Epidermolysis bullosa simplex Ogna type	Associate	28675510
Epilepsies Myoclonic	Inhibit	22152093
Epilepsies Partial	Associate	37563306
Epilepsy Temporal Lobe	Stimulate	22365585
Epstein Barr Virus Infections	Stimulate	10794603, 7507299
Epstein Barr Virus Infections	Associate	18240345, 21114920, 21796156, 23782909, 26638529, 8238244
Epstein Barr Virus Infections	Inhibit	8340752
Erectile Dysfunction	Associate	39809170
Erythema Multiforme	Associate	17880768
Esophageal Neoplasms	Associate	16011306, 24606472, 28487599, 28653878, 28713162, 31171890, 32258099, 32360515, 32426838
Esophageal Squamous Cell Carcinoma	Associate	10514383, 10601836, 20193114, 22477709, 23955799, 25438156, 26132559, 28488526, 32071920, 34257544, 36474162
Fallopian Tube Diseases	Associate	34746304
Fallopian Tube Neoplasms	Associate	22038216
Familial cylindromatosis	Stimulate	32901872
Familial Primary Pulmonary Hypertension	Associate	21037114, 31336611, 34722766
Fanconi Anemia	Associate	34954697
Fatigue	Associate	23047795
Fatty Liver	Associate	17036395
Fetal Growth Retardation	Inhibit	15502418
Fetal Growth Retardation	Associate	25271252
Fetal Membranes Premature Rupture	Associate	30536268
Fever	Associate	24728004, 31450899
Fibroadenoma	Associate	19383306
Fibrocartilaginous embolism	Associate	30936926
Fibrosis	Associate	16423888, 17318196, 23497522, 34951993, 8129031
Fibrous Dysplasia of Bone	Associate	35220546
Focal Nodular Hyperplasia	Associate	8129031
Follicular Cyst	Associate	2704746, 8449825
Friedreich Ataxia 1	Associate	26422859
Frontotemporal Dementia	Associate	32727073
Fused Teeth	Associate	23341189, 23600716, 24625454, 26573234, 26931436, 29903764, 30348671, 31518494, 33339535
Gallbladder Neoplasms	Associate	29513793, 34118139
Gastritis Atrophic	Associate	15492912
Gastro enteropancreatic neuroendocrine tumor	Associate	26450156
Gastroesophageal Reflux	Associate	20931420
Gastrointestinal Diseases	Associate	22568453
Gastrointestinal Neoplasms	Associate	15961081, 32883271, 8063611
Gastrointestinal Stromal Tumors	Associate	16518826, 17552015, 25898773, 26617858, 27649657
GATA2 Deficiency	Associate	11472349
Genetic Diseases Inborn	Associate	1485535, 23297126, 31315646
Genetic Diseases Inborn	Stimulate	31109360
Genomic Instability	Associate	24481442
Gingival Diseases	Associate	31743516, 33934404
Gingival Neoplasms	Associate	24972848
Gingival Overgrowth	Associate	23965458
Glioblastoma	Associate	10567494, 12558990, 16688362, 18357521, 20730317, 21880871, 23152057, 24287948, 24757258, 26775694, 27533080, 29236891, 29520102, 30248541, 30385739 View all (5 more)
Glioma	Associate	10361224, 11175638, 12085183, 15584904, 16319070, 16688362, 16875495, 18327814, 18670645, 19208740, 19289490, 20511184, 21122152, 21279667, 21364627 View all (34 more)
Gliosarcoma	Associate	28193280
Gliosis	Inhibit	21468591
Glomerulonephritis	Associate	8587248
Glomerulonephritis IGA	Associate	26460503
Glomerulonephritis Membranous	Associate	23382857
Glucosephosphate Dehydrogenase Deficiency	Associate	32722781
Glycogen Storage Disease Type II	Associate	35605642
Glycogen Storage Disease Type IV	Associate	11877266
Glycogen Storage Disease Type IV	Stimulate	30548945
Goiter Nodular	Associate	29250672
Graft vs Host Disease	Stimulate	32247860
Granular Cell Tumor	Associate	20976415
Granuloma Giant Cell	Associate	21706237, 31655833
Graves Disease	Associate	15351796, 16219172, 19008632, 7627264
Hairy palms and soles	Stimulate	15929186
Hashimoto Disease	Associate	16219172, 7730485
Haspeslagh Fryns Muelenaere syndrome	Associate	10655200, 29164949
Head and Neck Neoplasms	Associate	22160615, 22393978, 23479508, 23719266, 23734725, 24019973, 24554038, 30961650
Heart Diseases	Associate	35230891, 9099657
Heart Failure	Associate	10091822, 10841223, 25961010, 38241555, 9099657
Heart Failure	Inhibit	30968846
Helicobacter Infections	Stimulate	14716828
Hemangioma	Associate	25816398
Hemangiopericytoma	Associate	26722515
Hematologic Diseases	Associate	22568453, 25333252
Hematologic Neoplasms	Associate	1391959, 1868240, 24516200, 25082878, 25599133, 30185782, 33376097, 33853293, 35058488, 36099249
Hepatitis Autoimmune	Stimulate	10209518
Hepatitis B	Associate	1375120, 28701032, 29209623, 31158261
Hepatitis C	Associate	11167830, 11877309, 16627984, 21281815, 27315061, 30351860
Hepatitis C	Stimulate	22951829
Hepatitis C Chronic	Associate	11023531, 24130824, 32050950
Hepatoblastoma	Associate	22202031
Hepatomegaly	Associate	17364991
Hereditary leiomyomatosis and renal cell cancer	Associate	12433696, 1656757, 16960154, 17296180, 1750500, 18758641, 19623262, 7531953, 8238244, 8385158
Hereditary leiomyomatosis and renal cell cancer	Stimulate	16962107
Heredodegenerative Disorders Nervous System	Associate	33972534
Herpes Simplex	Associate	10644366
Hirschsprung Disease	Associate	10583933
Histiocytosis Langerhans Cell	Associate	32738155
HIV Infections	Inhibit	10731928, 17162379, 21920046
HIV Infections	Associate	11165927, 11861282, 20962079, 26842479, 31719184, 33827940, 33980597, 9226175
Hodgkin Disease	Associate	12433696, 1632463, 1750500, 17510532, 17918256, 18758641, 19623262, 30941572, 7531953, 7852186, 8238244, 8274737, 8385158, 8434638
Hydatidiform Mole	Inhibit	21808961
Hydatidiform Mole	Associate	23065465, 37216303
Hyperaldosteronism	Associate	12085205
Hyperglycemia	Inhibit	16388709, 23985558
Hyperparathyroidism	Associate	10652020
Hyperplasia	Associate	14767488, 15188026, 1871110, 30521861, 9626044
Hyperprolactinemia	Stimulate	22420628
Hypertension	Associate	33973418
Hypertension	Inhibit	35306999
Hypothermia	Inhibit	19596001
Hypoxia	Stimulate	12173346, 17763440, 23403511, 29484432, 38285930, 40539846
Hypoxia	Associate	12663450, 14660675, 15790403, 15987743, 17352240, 18059169, 18670645, 19161638, 19211554, 20668552, 20829524, 21984181, 23289374, 23291726, 24119370 View all (10 more)
Hypoxia	Inhibit	23139748, 23681233
Hypoxia Brain	Associate	17201910, 20668552, 22457823, 27461218, 28000962
Hypoxia Brain	Stimulate	19666348
Hypoxia Brain	Inhibit	36401373
Hypoxia Ischemia Brain	Associate	35170135
Ichthyosis Bullosa of Siemens	Associate	34859100
Ichthyosis X Linked	Associate	37237151
Idiopathic Pulmonary Fibrosis	Stimulate	17219718
Immunoglobulin Light chain Amyloidosis	Associate	36694297
Infections	Associate	10233902, 10644366, 11568004, 24554662, 28794048, 9811703
Infections	Stimulate	21385331
Infections	Inhibit	23805250, 25005804
Infectious Mononucleosis	Associate	10792379, 12130505, 7531953, 8329707
Inferior Wall Myocardial Infarction	Stimulate	17395602
Inferior Wall Myocardial Infarction	Associate	29903764
Infertility	Associate	23218678
Inflammation	Associate	10704147, 11165927, 11570908, 16388709, 16533178, 16787530, 17036395, 17318196, 19123745, 21880146, 22182738, 23874838, 24718681, 25222269, 26251029 View all (11 more)
Inflammation	Inhibit	35742844
Inflammatory Bowel Diseases	Associate	31159239
Intervertebral Disc Degeneration	Associate	27593829, 33090383, 37525208
Intervertebral disc disease	Inhibit	18302283
Intestinal Diseases	Associate	15492912, 17589896, 22104313
Intestinal Neoplasms	Associate	15655830
Intracranial Aneurysm	Associate	34895131, 36248807
Intracranial Hypertension	Associate	32515262
Intraocular Lymphoma	Associate	16799010
Iron Deficiencies	Stimulate	37087978
Ischemia	Stimulate	23778338
Ischemic Stroke	Associate	32576868
Job Syndrome	Stimulate	29985426
Kartagener Syndrome	Associate	34601504
Keloid	Associate	31059100
Keratoacanthoma	Associate	35024732, 8891017
Keratoconus	Associate	34478492
Keratosis Actinic	Associate	16405608
Kidney Cortex Necrosis	Associate	11073823
Kidney Diseases	Associate	16388709, 17034587, 33551436, 8587248, 8755656
Kidney Diseases Cystic	Associate	14699151
Kidney Neoplasms	Associate	15357873, 17508219, 17541305, 31187116, 36933996
Langerhans Cell Sarcoma	Associate	30322385
Laryngeal Neoplasms	Associate	15928664, 16675913, 18519232, 28455995, 34268937, 35756421
Latent Tuberculosis	Associate	36197420
Leiomyoma	Associate	17652152, 25607395, 28483502, 29523174
Leiomyosarcoma	Associate	10408415, 23334251, 27140314
Leiomyosarcoma	Inhibit	25607395, 29653556
Leprosy	Associate	20964723, 29593724
Leukemia	Associate	10090946, 10194436, 10552958, 10554162, 11877295, 11895790, 12393493, 12423683, 15868938, 17352239, 17364991, 17603173, 18575824, 19447221, 19535347 View all (52 more)
Leukemia B Cell	Associate	11572760, 1391959, 15143340, 15242877, 1632463, 18575824, 18633450, 20103721, 22686190, 23449635, 23957733, 2682663, 30843876, 37140301, 9207405
Leukemia Biphenotypic Acute	Associate	15384977, 27317766, 39506897
Leukemia Hairy Cell	Associate	11128872, 1638028, 38440808, 8686741
Leukemia Large Granular Lymphocytic	Associate	17162379
Leukemia Lymphocytic Chronic B Cell	Associate	10086798, 10438728, 10583267, 10666220, 10887097, 11380405, 12176902, 12560233, 12580957, 1375120, 1402678, 14687023, 15367432, 16166262, 1632463 View all (89 more)
Leukemia Lymphoma Adult T Cell	Associate	15638862, 16603085, 25185513, 37102641
Leukemia Mast Cell	Stimulate	10072109
Leukemia Monocytic Acute	Inhibit	31253168
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	18534064, 1868240, 19141860, 20401760, 20704577, 22033489, 22517119, 24585095, 25333252, 26431162, 27832139, 33707419, 40576928
Leukemia Myeloid	Associate	10648417, 12170773, 15642706, 1638028, 33439746, 34463267, 8025271, 8161792, 8943060
Leukemia Myeloid Acute	Associate	10233386, 10845930, 12393493, 12417757, 15203866, 15367432, 1536952, 17105820, 17498302, 18160664, 18715689, 20557671, 21595920, 21998731, 23798675 View all (58 more)
Leukemia Myeloid Acute	Stimulate	24615181
Leukemia Myelomonocytic Chronic	Associate	12111784, 15808401
Leukemia Plasma Cell	Associate	26722442, 33786907, 35171994
Leukemia Prolymphocytic B Cell	Associate	31527074, 9551917
Leukemia Prolymphocytic T Cell	Associate	11886380, 15982342, 15982345, 16156855, 20813004, 21750559, 22171982, 22686190, 26493374, 28972014, 31821686, 37743239, 9163608, 9328155
Leukemia Promyelocytic Acute	Associate	25088254, 36098742, 8611710, 9129041
Leukemia T Cell	Associate	14687023, 18422996, 19737931, 26839633, 32452017, 35103292, 8830674, 9722299
Leukemic Infiltration	Associate	19056541
Leukocyte adhesion deficiency type 1	Associate	31545280
Leukodystrophy Globoid Cell	Associate	36983059
Leukoplakia	Associate	15995578, 22124045, 26960457
Leydig Cell Tumor	Associate	38387140
Lichen Planus Oral	Associate	15995578, 19325208, 22124045, 39798779
Lipoma	Associate	23786924
Liposarcoma	Associate	21693658
Liver Cirrhosis Biliary	Associate	11457875
Liver Diseases	Associate	16423888
Liver Failure	Stimulate	28876364
Liver Neoplasms	Associate	8129031
Long QT Syndrome	Associate	26497387
Lung Diseases	Associate	12833466, 30941978
Lung Diseases Interstitial	Associate	30843876, 9039233
Lung Neoplasms	Associate	10063313, 10896673, 11054026, 12421819, 15210690, 15753661, 17091766, 18483303, 19878573, 22316209, 22665367, 23792636, 23894143, 23977251, 24289612 View all (17 more)
Lupus Erythematosus Systemic	Associate	17034587, 19423430, 26617807, 34044633, 39366755
Lupus Erythematosus Systemic	Stimulate	17162369, 9822266
Lupus Erythematosus Systemic	Inhibit	18507053, 9251841
Lupus Nephritis	Associate	17034587, 37102641
Lupus Nephritis	Stimulate	8587248
Lymphatic Diseases	Associate	1824261
Lymphatic Metastasis	Associate	14669273, 15274378, 16080576, 16101192, 17477770, 19385591, 20691103, 22038216, 23955799, 24228120, 24741635, 25066397, 25840688, 28106544, 36374147
Lymphatic Metastasis	Inhibit	21861179
Lymphatic Metastasis	Stimulate	21936874, 34257544
Lymphedema Hereditary IB	Associate	12210808
Lymphoma	Associate	11167744, 11600428, 11747333, 12406872, 1376556, 1419624, 14726400, 1498325, 15143340, 15543568, 15713621, 16373664, 1638027, 1638028, 18575824 View all (126 more)
Lymphoma	Stimulate	11929754, 29785017
Lymphoma B Cell	Associate	11929754, 11964306, 12210808, 12644474, 1312610, 14726400, 15578884, 15787160, 16277553, 1632463, 1633729, 17473827, 17681667, 17921040, 1868240 View all (90 more)
Lymphoma B Cell Marginal Zone	Associate	10079376, 1376556, 1951637, 22686190, 2672827, 26763367, 36853790, 7706514
Lymphoma Follicular	Associate	10193514, 10216105, 10233841, 10362812, 10452515, 10498595, 10555759, 10583231, 10828038, 10961899, 11435322, 11756183, 11781262, 11964306, 12036852 View all (153 more)
Lymphoma Follicular	Inhibit	27283896
Lymphoma Large B Cell Diffuse	Associate	11389007, 11762818, 11830458, 12075054, 12169673, 12402391, 12406872, 12576316, 12649152, 12749011, 12967475, 14726400, 15115829, 15215171, 15242877 View all (172 more)
Lymphoma Large B Cell Diffuse	Inhibit	29021515
Lymphoma Large Cell Anaplastic	Associate	11485911, 12036886, 22365399
Lymphoma Large Cell Immunoblastic	Associate	8435363
Lymphoma Mantle Cell	Associate	10452515, 11468180, 1633729, 17227835, 1868240, 18984860, 19821820, 25797245, 26285204, 26517511, 27157620, 27697772, 28035065, 32239765, 32273477 View all (11 more)
Lymphoma Mantle Cell	Stimulate	12472567
Lymphoma Non Hodgkin	Associate	10468853, 10794603, 11023531, 11380403, 11979307, 12701113, 1311213, 1339299, 14513368, 14978135, 1498325, 15669024, 15846077, 16156855, 1632463 View all (32 more)
Lymphoma Non Hodgkin	Inhibit	9802885
Lymphoma Primary Effusion	Associate	11836434, 35058488, 36416587
Lymphoma T Cell	Associate	11133771, 1391959, 1868240, 22322190, 26068772, 34603598, 8089211
Lymphoma T Cell Cutaneous	Associate	11675351, 18496567, 28972015, 32437546, 35787399
Lymphoproliferative Disorders	Associate	11877309, 15846077, 16803564, 22868923, 36375119, 8089211, 8111048, 8555494
Lysinuric Protein Intolerance	Associate	22855608
Malformations of Cortical Development	Associate	16302851
Malformations of Cortical Development Group I	Associate	10737620, 12867423, 12911627, 18782442, 20062536, 20476668, 21878650, 26025363, 28824303, 31646584, 36973772, 9354939
Malformations of Cortical Development Group I	Inhibit	12207829, 17094488, 9192772
Malnutrition	Associate	21818634
Mammary Neoplasms Animal	Associate	16127422
Mastocytosis	Stimulate	12937123
Mastocytosis Cutaneous	Associate	12937123
Meckel syndrome type 1	Stimulate	10793071
Medulloblastoma	Associate	24887326, 26394044, 9060818
Melanoma	Associate	10361224, 11511312, 11676832, 11874491, 11959101, 12177306, 12669250, 14660675, 14757835, 15140231, 15205682, 15314285, 15858118, 15987743, 16528364 View all (40 more)
Melanoma	Stimulate	38166464
Melanoma	Inhibit	7534042
Melanoma Cutaneous Malignant	Associate	18570663, 21108607, 7534042
Meningeal Carcinomatosis	Associate	28193280
Meningioma	Associate	26240495, 28340489
Mesothelioma	Associate	11485930, 17224645, 21697949
Mesothelioma Malignant	Associate	19815709, 29094504
Metabolic Diseases	Associate	33398046
Metaplasia	Associate	19393583
Metrorrhagia	Associate	16250278
Minicore Myopathy with External Ophthalmoplegia	Associate	28362510
Mitochondrial Diseases	Inhibit	11461904, 15802021, 29516570, 29745075, 31995555, 9621051
Mitochondrial Diseases	Associate	11568006, 12170773, 12644018, 15138206, 15175350, 15494423, 16098144, 16702969, 16749867, 16778220, 16980304, 17323348, 17942397, 18670645, 18829556 View all (24 more)
Mitochondrial Myopathies	Associate	17551003
Mixed Tumor Malignant	Associate	12391455, 7887447
Mouth Diseases	Associate	12172574, 15236993, 16019350, 24127964, 34762658, 7730485
Mouth Diseases	Stimulate	12937123
Mouth Neoplasms	Associate	12172574, 17764575, 20430729, 23119114, 29332355
Mucocutaneous Lymph Node Syndrome	Associate	11703382
Mucocutaneous Lymph Node Syndrome	Inhibit	37506144
Multiple Myeloma	Associate	10216101, 10583232, 11146157, 11175262, 11495702, 11886382, 12391322, 12521996, 12707028, 1415486, 15070697, 15741217, 17200714, 1730093, 17332241 View all (42 more)
Multiple Myeloma	Inhibit	11985351
Multiple Sclerosis	Stimulate	16295526
Multiple Sclerosis	Associate	36725329
Muscular Atrophy	Associate	35605642
Muscular Disorders Atrophic	Associate	10595928
Muscular Disorders Atrophic	Stimulate	16405608
Muscular dystrophy congenital with central nervous system involvement	Associate	28209136
Muscular Dystrophy Duchenne	Inhibit	20476668
Myasthenia Gravis	Associate	17354625
Mycosis Fungoides	Associate	31648231
Myelocytic leukemia like syndrome familial chronic	Stimulate	33836616
Myelodysplastic Syndromes	Associate	12111784, 14594556, 22964015, 26398525, 27665715, 34548471, 8943864, 9716007, 9744502, 9886323
Myocarditis	Stimulate	17007104
Myoclonic dystonia	Associate	34288263
Myositis Inclusion Body	Associate	11570908
Myxoma	Associate	18198753
Nasopharyngeal Carcinoma	Associate	20514538, 21114920, 21388911, 23777485, 24157866, 24961145, 25031780, 25227792, 25337187, 26795575, 29256858, 29991129, 31634779, 34064109, 34224316, 38009194, 38149563 View all (2 more)
Nasopharyngeal Neoplasms	Associate	20514538, 36225172
Necrosis	Associate	11414470, 11600428, 12036455, 14748742, 17094488, 20062536, 23907460, 25197664, 29854577, 40542009
Necrosis	Inhibit	9514059
Neoplasm Invasiveness	Associate	16675913, 21556123
Neoplasm Metastasis	Associate	10070896, 15112275, 15235888, 16619475, 16675913, 16826579, 17541305, 18570663, 18985814, 19631957, 20119576, 20495533, 20514538, 23497522, 26632252 View all (9 more)
Neoplasm Metastasis	Inhibit	12170764, 21861179, 7734290
Neoplasms	Associate	10037278, 10063313, 10070896, 10096969, 10097113, 10399627, 10487853, 10498595, 10607921, 10646898, 10666369, 10682669, 10706869, 10780524, 10780525 View all (525 more)
Neoplasms	Inhibit	10944610, 11487260, 12871207, 15628988, 16473926, 18458532, 19043216, 19047121, 20010695, 21358618, 22160615, 23364795, 23613234, 24099794, 24895601 View all (8 more)
Neoplasms	Stimulate	12433696, 12576316, 19852810, 20082858, 22038216, 23244222, 38072891, 9020491
Neoplasms Germ Cell and Embryonal	Associate	9635829
Neoplasms Glandular and Epithelial	Associate	36412397, 7706514
Neoplasms Neuroepithelial	Stimulate	21468591
Neoplasms Squamous Cell	Associate	18272816, 20459695, 24972848, 31257524, 34790046
Nephritis	Associate	8587248
Nerve Degeneration	Associate	10737620, 11815632, 12186923, 21878650
Neuralgia	Associate	28004108
Neuroblastoma	Associate	17702766, 18036348, 18325115, 18836721, 19556859, 19813266, 21159604, 21290341, 22040216, 23317647, 23341456, 25292042, 25756510, 26859456, 27866306 View all (7 more)
Neurodegenerative Diseases	Associate	36983059
Neuroendocrine Tumors	Associate	10491014, 15072592, 8774138, 8952529
Neurofibroma	Associate	24346802
Neurofibrosarcoma	Associate	24346802
Neuroinflammatory Diseases	Associate	35742844
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	14764541
Nevus	Associate	7534042, 7887447
Nevus	Inhibit	8053490
Nevus Pigmented	Associate	12535197
NOG Related Symphalangism Spectrum Disorder	Associate	28417194
Non alcoholic Fatty Liver Disease	Associate	17036395, 28216552
Non alcoholic Fatty Liver Disease	Inhibit	20888662
Non Muscle Invasive Bladder Neoplasms	Associate	30875757
Obesity	Associate	23193206
Oculomotor Nerve Diseases	Associate	15361203
Odontogenic Cysts	Associate	22207432, 24025887, 26434831, 29508125, 31967981, 32632899
Odontogenic Tumors	Associate	23951062, 24025887, 28390134
Odontoma	Associate	19192639
Oncocytoma renal	Associate	21590491
Oral Submucous Fibrosis	Associate	22124045
Organizing Pneumonia	Stimulate	30548945
Oropharyngeal Neoplasms	Associate	22009819, 25380690
Osteoarthritis	Associate	31405216, 33540799, 36879307
Osteoarthritis Hip	Associate	33540799
Osteochondritis	Associate	30483788
Osteochondroma	Associate	11140704
Osteoglophonic dwarfism	Associate	31251836
Osteoglophonic dwarfism	Inhibit	35609324, 36372373
Osteoporotic Fractures	Associate	39456222
Osteosarcoma	Associate	15112275, 17632732, 23568006, 24570183, 24961347, 25677904, 26569226, 26707422, 26744308, 26823739, 27735939, 27813492, 28618955, 28837148, 29509239 View all (12 more)
Oto palato digital syndrome type 2	Inhibit	35905946
Ovarian Diseases	Associate	10666369, 25510701
Ovarian Neoplasms	Associate	10646901, 10679744, 10780525, 12036450, 12644821, 16138714, 19028702, 19517469, 19755862, 20082279, 22052903, 22843880, 22995373, 23277286, 23333498 View all (30 more)
Ovarian Neoplasms	Inhibit	17575110, 27462919
Paget's Disease Mammary	Associate	25735328
Pagetoid Reticulosis	Stimulate	29760516
Pancreatic Diseases	Associate	21963730
Pancreatic Neoplasms	Associate	10362119, 11226429, 11953819, 12865934, 15309737, 15884114, 16109447, 17201167, 17378914, 19966835, 21714853, 21720559, 21909380, 22246103, 23954445 View all (13 more)
Pancreatic Neoplasms	Stimulate	20646298
Pancreatitis Chronic	Associate	11889077, 15622002
Papillary Thyroid Microcarcinoma	Associate	19683979
Papillary Thyroid Microcarcinoma	Stimulate	26863116
Papillomavirus Infections	Associate	10393359
Papillomavirus Infections	Stimulate	12759237
Paraganglioma	Associate	12067490
Paraneoplastic Syndromes	Associate	25120759
Paraproteinemias	Associate	1868240
Parathyroid Neoplasms	Associate	18492387, 22198862
Parkinson Disease	Associate	24256571, 30221494, 34204164
Pelvic Inflammatory Disease	Associate	2540855, 36196757
Pelvic Organ Prolapse	Associate	21674599
Pemphigoid Bullous	Stimulate	16388717
Penile Induration	Associate	23356197
Periapical Diseases	Associate	35195153
Periapical Periodontitis	Associate	35804353
Periodontal Diseases	Associate	39337647
Periodontitis	Associate	16787530, 30593206
Peritonitis	Associate	10793072
Personality Disorders	Associate	12575847, 22424533, 24740354, 36934096, 7612493
Philadelphia Chromosome	Associate	39506897
Philadelphia Chromosome	Inhibit	8562940
Pilomatrixoma	Associate	20495544
Pituitary Neoplasms	Inhibit	10079254
Pituitary Neoplasms	Associate	10780524, 18273074, 23334699, 29556628, 8943742
Plaque Atherosclerotic	Associate	34513076
Plasmacytoma anaplastic	Associate	22182738
Pleural Effusion	Associate	22159518
Polycystic Ovary Syndrome	Associate	26868993, 33287836, 34784951, 35288480, 35393909
Polycythemia Vera	Associate	19060244
Polyps	Associate	11194193, 9293892
Porphyria Variegate	Inhibit	20331452
Pre Eclampsia	Inhibit	15502418, 22837649
Pre Eclampsia	Associate	31477211, 34650122
Precancerous Conditions	Associate	15929186, 23977251, 26446460
Precancerous Conditions	Stimulate	37530327
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	31776129, 3186743, 32111748, 35436854, 36674872, 36867579, 38175445, 7811993
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	14508797, 17364991, 18024393, 18046449, 18575824, 18618503, 22031455, 23494176, 24088574, 27008505, 28718205, 30985716, 32102534, 33830207, 35091682 View all (9 more)
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10848789, 11091199, 11520803, 12139741, 12780787, 15203866, 15353558, 15384977, 16445836, 20103721, 20148885, 26265185, 30361682, 30596398, 32377726 View all (7 more)
Prediabetic State	Inhibit	35237235
Primary Myelofibrosis	Associate	18838203
Primary Myelofibrosis	Inhibit	22300941
Primary Ovarian Insufficiency	Associate	40696610
Prodromal Symptoms	Associate	17192048, 37563306
Progressive Transformation of Germinal Centers	Associate	22929980
Prolactinoma	Associate	10780524, 8943742
Prostate cancer familial	Associate	30183767
Prostatic Diseases	Associate	9865831
Prostatic Hyperplasia	Associate	16309180, 16827116, 30295140, 37378942, 9186362
Prostatic malacoplakia associated with prostatic abscess	Associate	16080576
Prostatic Neoplasms	Associate	10884916, 11061345, 11495901, 11500787, 11692148, 12086875, 12170775, 12170776, 12496485, 12644474, 14692814, 15655565, 15790403, 16015611, 16080576 View all (54 more)
Prostatic Neoplasms	Stimulate	19050681, 37378942
Prostatic Neoplasms Castration Resistant	Associate	25027405, 29460131, 31228231, 37047425
Prostatic stromal proliferation of uncertain malignant potential	Associate	10780525, 22124045
Prostatitis	Associate	11061345, 11437412, 11495901, 12655519, 16015611, 16827116, 19495772, 22395836, 26823840, 30741252, 8080038
Prostatitis	Stimulate	9865831
Protein C Deficiency	Associate	34112885
Proteinuria	Associate	8587248
Pseudolymphoma	Associate	15669024, 2540855
Pterygium	Stimulate	21738398
Pulmonary Disease Chronic Obstructive	Associate	10704078, 20423464, 28494757, 32158203, 35431545
Pulmonary Fibrosis	Associate	33601175, 9327733
Purpura Thrombocytopenic Idiopathic	Associate	16368066, 17548576
Pyruvate Carboxylase Deficiency Disease	Associate	22182738
Radicular Cyst	Associate	22207432
Rectal Diseases	Associate	16830272
Rectal Fistula	Associate	37382254
Rectal Neoplasms	Associate	15300917, 17406756, 25064172
Recurrence	Associate	27002765
Renal Insufficiency	Associate	16080576, 26627102
Renal Tubular Acidosis Distal With Normal Red Cell Morphology	Associate	7856728
Reperfusion Injury	Associate	19596001
Reproductive Tract Infections	Associate	19114327
Respiratory Tract Infections	Associate	22977664
Retinal Detachment	Associate	25991504
Retinal Diseases	Associate	37811624
Retinal Dysplasia	Associate	14606101, 16533178, 7599047
Retinal Dysplasia	Stimulate	17632454
Retinoblastoma	Associate	30694025, 32329827, 36284668
Rhabdomyosarcoma	Associate	17896786, 28617441
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	25991504
Rheumatic Heart Disease	Associate	33073840
Ring Chromosome 20 Syndrome	Stimulate	31251836
Ring Chromosome 20 Syndrome	Associate	31808877, 34825305
Rotator Cuff Injuries	Associate	30424787
Rufous oculocutaneous albinism	Associate	11877266, 15361203, 8547651
Salivary Gland Adenoma Pleomorphic	Associate	24740354, 33737504
Salivary Gland Neoplasms	Associate	21196881, 22313995
Sarcoidosis	Associate	11641969
Sarcoidosis	Stimulate	17219718
Sarcoma	Associate	17643097
Sarcoma Endometrial Stromal	Associate	15309019
Sarcoma Ewing	Associate	21844121, 33719644
Sarcoma Kaposi	Associate	10079372, 11165927, 11836434, 26456186, 31252633, 37032379, 8644847, 9740222
Sarcoma Synovial	Associate	10879732, 11487273, 12218218, 16450387, 19936258, 20082858, 27401493
Schistosomiasis	Associate	16308474
Schizophrenia	Associate	37376599
Scleroderma Diffuse	Associate	33070565
Scoliosis	Associate	31337422
Seizures	Associate	22365585
Sertoli Cell Only Syndrome	Associate	27773559, 30523716, 37198234
Severe Acute Respiratory Syndrome	Associate	19610265
Sexual Dysfunction Physiological	Associate	25562170
Shock Septic	Associate	22710204, 28270177
Sick Sinus Syndrome	Associate	18430249, 7710955
Sick Sinus Syndrome 1 Autosomal Recessive	Associate	16043935
Sjogren's Syndrome	Associate	12472667, 1940802, 35359935
Skin Diseases	Associate	32247860
Sleep Deprivation	Inhibit	10935471
Small Cell Lung Carcinoma	Associate	10491014, 12421819, 16479062, 17426248, 18785266, 20922271, 21063403, 21107291, 21282543, 21984896, 23651505, 25758528, 26008974, 26311051, 26722503 View all (12 more)
Smooth Muscle Tumor	Associate	10408415, 22457823, 25607395, 28004108
Soft Tissue Injuries	Associate	27140314
Solitary Fibrous Tumors	Associate	24708790, 26722515, 34502329, 40660115
Somatoform Disorders	Associate	25311808
Spastic paraplegia 11 autosomal recessive	Associate	8707954
Splenic Neoplasms	Associate	16799206
Splenomegaly	Stimulate	17364991
Squamous Cell Carcinoma of Head and Neck	Associate	12454767, 15842252, 15917659, 16254104, 16413463, 16413471, 16551875, 16675913, 17971900, 18566236, 19196738, 19240170, 20448381, 21936874, 22124045 View all (20 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	19484147
Squamous Cell Carcinoma of Head and Neck	Inhibit	33840043
Squamous Intraepithelial Lesions	Stimulate	17694953
Squamous Intraepithelial Lesions	Associate	39941094
Stevens Johnson Syndrome	Associate	17880768
Stomach Diseases	Associate	15786529, 20065505, 34585958, 8063611
Stomach Neoplasms	Associate	10816444, 11714446, 12679905, 14606069, 14695762, 14716828, 14769213, 15188515, 15754411, 15793875, 15976908, 16340247, 16582585, 17477770, 18158559 View all (58 more)
Stomach Neoplasms	Stimulate	8063611
Striae Distensae	Inhibit	28784087
Subarachnoid Hemorrhage	Associate	34895131
Synovial Cyst	Associate	9158086
Tachycardia Atrioventricular Nodal Reentry	Stimulate	17243518
Tachycardia Atrioventricular Nodal Reentry	Associate	17352236, 1951637
Tarlov Cysts	Associate	24554038
Teratoma	Associate	29540256
Tertiary Lymphoid Structures	Associate	12701113, 16358373, 17242701, 18570663, 20514538, 23119114, 28718205, 29653556, 30583683
Testicular Germ Cell Tumor	Associate	17643097, 9041117
Thanatophoric Dysplasia	Inhibit	12929929, 9582336
Thrombocythemia Essential	Inhibit	22300941
Thrombocythemia Essential	Associate	22418850
Thrombocytosis	Associate	29068570
Thrombotic Microangiopathies	Associate	9840908
Thymoma	Associate	12049674, 34135467
Thymus Hyperplasia	Associate	28718205
Thymus Neoplasms	Associate	14631373, 24788952
Thyroid cancer Hurthle cell	Associate	11786411
Thyroid cancer medullary	Associate	9626044
Thyroid Cancer Papillary	Associate	24081676, 25868389, 25908172, 26429174, 30872410, 31378899, 31842912, 9052406
Thyroid Carcinoma Anaplastic	Associate	21571321
Thyroid Neoplasms	Associate	11005209, 18021179, 19878585, 23250731, 24718460, 26422859, 30272326, 31786883, 35388548, 35968508, 8546897
Thyroiditis	Associate	19008632
Thyroiditis Autoimmune	Associate	16219172, 24048795, 29250672, 7605982
Tongue Neoplasms	Associate	28983595
Tricuspid Valve Stenosis	Associate	37108591
Triple Negative Breast Neoplasms	Associate	17976237, 23621182, 23908177, 25179840, 25616695, 26045046, 27217294, 27472710, 28777433, 31742868, 31870109, 33990623, 34970732, 35056723, 36510982 View all (5 more)
Triple Negative Breast Neoplasms	Stimulate	24965402
Trisomy	Associate	35705274
Trisomy 18 Syndrome	Associate	20495544
Tuberculosis	Associate	10444255, 36197420
Tuberculosis	Stimulate	24885723
Tuberculosis Meningeal	Associate	31838216
Tuberculosis Multidrug Resistant	Associate	20193114, 20942457, 24637737, 24805866, 28869936, 30126848, 33079995, 36411649
Urethral Neoplasms	Stimulate	16475721
Urethral Neoplasms	Associate	18334837, 29312470, 33786632
Urinary Bladder Neoplasms	Associate	15517890, 16984978, 18751404, 19122685, 19682434, 22797576, 23495258, 23613234, 23621258, 23656495, 23725146, 24595931, 25566965, 26198047, 26427661 View all (10 more)
Urinary Bladder Neoplasms	Stimulate	24870742
Urinary Incontinence Stress	Associate	30426803
Uterine Cervical Diseases	Associate	19940548, 36412398
Uterine Cervical Dysplasia	Associate	12759237, 15563666, 15684608, 16123814, 19940548
Uterine Cervical Neoplasms	Associate	10037278, 15361203, 15517869, 15889622, 16619552, 19940548, 21556123, 21704150, 23803076, 24634186, 24782650, 25142231, 26474854, 26482612, 26681053 View all (24 more)
Uterine Cervicitis	Associate	21556123, 31889428
Uterine Cervicitis	Stimulate	26681053
Uterine Diseases	Associate	15497492, 21804459, 40256590
Uterine Hemorrhage	Associate	16250278
Uveal melanoma	Associate	10209447, 22848417, 24014050, 7573354
Varicella Zoster Virus Infection	Inhibit	8340752
Varicocele	Stimulate	17475608
Varicocele	Associate	19666348
Varicose Ulcer	Associate	15929186, 7710955
Varicose Veins	Associate	15531194, 28818228
Vascular Diseases	Associate	27460740
Vascular Neoplasms	Associate	10780524
Vasculitis	Associate	11877309
Virilism	Associate	12644474
Virus Diseases	Associate	29053589, 8340752
Vitamin D Deficiency	Associate	26931436
Vitreoretinopathy Proliferative	Associate	25991504
Waldenstrom Macroglobulinemia	Associate	10444255, 25893290, 26002963, 28548645, 28771100, 33356554, 34793256, 36282673
Wilms Tumor	Associate	11720445
Wiskott Aldrich Syndrome	Inhibit	10572103
Yin Deficiency	Associate	15929186

BCL2 (BCL2 apoptosis regulator)