BCAN (brevican)

Gene Gene information from NCBI Gene database.
Gene SNPs Other IDs Associated diseases
Entrez ID 63827
Gene name Brevican
Gene symbol BCAN
Synonyms (NCBI Gene)
BEHABCSPG7
Chromosome 1
Chromosome location 1q23.1
Summary This gene encodes a member of the lectican family of chondroitin sulfate proteoglycans that is specifically expressed in the central nervous system. This protein is developmentally regulated and may function in the formation of the brain extracellular mat
miRNA miRNA information provided by mirtarbase database.
173
Gene SNPs Other IDs Associated diseases
Show/Hide all (173)
miRTarBase ID miRNA Experiments Reference
MIRT021697 hsa-miR-133a-3p Microarray 21396852
MIRT489342 hsa-miR-3938 PAR-CLIP 20371350
MIRT489341 hsa-miR-4780 PAR-CLIP 20371350
MIRT489340 hsa-miR-6780b-3p PAR-CLIP 20371350
MIRT489339 hsa-miR-2276-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene SNPs Other IDs Associated diseases
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development IBA
GO:0005515 Function Protein binding IPI 32814053
GO:0005540 Function Hyaluronic acid binding IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Other IDs Associated diseases
MIM HGNC e!Ensembl
600347 23059 ENSG00000132692
Protein Protein information from UniProt database.
Gene SNPs Other IDs Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96GW7
Protein name Brevican core protein (Brain-enriched hyaluronan-binding protein) (BEHAB) (Chondroitin sulfate proteoglycan 7)
Protein function May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 41 → 155 Immunoglobulin V-set domain Domain
PF00193 Xlink 157 → 251 Extracellular link domain Domain
PF00193 Xlink 258 → 353 Extracellular link domain Domain
PF00008 EGF 650 → 680 EGF-like domain Domain
PF00059 Lectin_C 705 → 810 Lectin C-type domain Domain
PF00084 Sushi 815 → 871 Sushi repeat (SCR repeat) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the retina, specifically in the inner nuclear layer, inner plexiform layer and ganglion cell layer (at protein level) (PubMed:29777959). Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in uri
Sequence 
MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACA
RIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDH
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALW
AWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPT
ETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRA
PEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGT
CLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYG
AHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLS
GENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVL
RYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKAL
LIPPSSPMPGP
Sequence length 911
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene SNPs Other IDs Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
High myopia Uncertain significance rs200282065 RCV000785737
Show/Hide Text Mining Associations (15)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32337264
Alzheimer Disease Inhibit 36982604
Astrocytoma Associate 21997179
Autism Spectrum Disorder Associate 38355786
Brain Injuries Stimulate 30980710
Brain Injuries Traumatic Inhibit 30980710
Dementia Vascular Associate 39909351
Glioblastoma Stimulate 33694259
Glioma Associate 11054543, 23253190, 25748242, 28161812
Hydrocephalus Associate 22186713