Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	572
Gene name	BCL2 associated agonist of cell death
Gene symbol	BAD
Synonyms (NCBI Gene)	BBC2BCL2L8
Chromosome	11
Chromosome location	11q13.1
Summary	The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large)

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038239	hsa-miR-330-5p	CLASH	23622248
MIRT814403	hsa-miR-1915	CLIP-seq
MIRT814404	hsa-miR-3124-5p	CLIP-seq
MIRT814405	hsa-miR-361-3p	CLIP-seq
MIRT814406	hsa-miR-4281	CLIP-seq
MIRT814407	hsa-miR-4283	CLIP-seq
MIRT814408	hsa-miR-4449	CLIP-seq
MIRT814409	hsa-miR-4685-5p	CLIP-seq
MIRT814410	hsa-miR-4761-3p	CLIP-seq
MIRT814411	hsa-miR-4783-3p	CLIP-seq
MIRT814403	hsa-miR-1915	CLIP-seq
MIRT814412	hsa-miR-3174	CLIP-seq
MIRT814413	hsa-miR-3177-3p	CLIP-seq
MIRT814405	hsa-miR-361-3p	CLIP-seq
MIRT814414	hsa-miR-3663-3p	CLIP-seq
MIRT814415	hsa-miR-4477a	CLIP-seq
MIRT814409	hsa-miR-4685-5p	CLIP-seq
MIRT814410	hsa-miR-4761-3p	CLIP-seq
MIRT814416	hsa-miR-921	CLIP-seq
MIRT2483221	hsa-miR-1203	CLIP-seq
MIRT2483222	hsa-miR-1275	CLIP-seq
MIRT2483223	hsa-miR-149	CLIP-seq
MIRT2483224	hsa-miR-1908	CLIP-seq
MIRT2483225	hsa-miR-3141	CLIP-seq
MIRT2483226	hsa-miR-3153	CLIP-seq
MIRT2483227	hsa-miR-3616-3p	CLIP-seq
MIRT2483228	hsa-miR-3940-3p	CLIP-seq
MIRT2483229	hsa-miR-4293	CLIP-seq
MIRT2483230	hsa-miR-4525	CLIP-seq
MIRT2483231	hsa-miR-4665-5p	CLIP-seq
MIRT2483232	hsa-miR-4721	CLIP-seq
MIRT2483233	hsa-miR-4723-5p	CLIP-seq
MIRT2483234	hsa-miR-490-3p	CLIP-seq
MIRT2483235	hsa-miR-544b	CLIP-seq
MIRT2483236	hsa-miR-566	CLIP-seq
MIRT2483237	hsa-miR-625	CLIP-seq
MIRT2483238	hsa-miR-637	CLIP-seq
MIRT2483239	hsa-miR-661	CLIP-seq
MIRT2483240	hsa-miR-663	CLIP-seq
MIRT2483241	hsa-miR-744	CLIP-seq
MIRT2483223	hsa-miR-149	CLIP-seq
MIRT2483234	hsa-miR-490-3p	CLIP-seq
MIRT2483236	hsa-miR-566	CLIP-seq
MIRT2483239	hsa-miR-661	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NR3C1	Activation	17496926
PPARG	Activation	14960510
RELA	Activation	20596645

Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0005515	Function	Protein binding	IPI	9388232, 9463381, 9973195, 10949025, 11526496, 15131699, 15694340, 16189514, 17446862, 17485524, 17979178, 19427857, 19427863, 19667065, 20005908, 20179209, 20603619, 20936779, 21081150, 21900206, 21988832, 22000515, 23397142, 24008843, 24255178, 25241761, 25416956, 26871637, 285144
GO:0005543	Function	Phospholipid binding	IMP	21081150
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	20700721
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	20700721
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006007	Process	Glucose catabolic process	IEA
GO:0006915	Process	Apoptotic process	IDA	19667065
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	7834748
GO:0008289	Function	Lipid binding	IDA	19667065
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0010508	Process	Positive regulation of autophagy	TAS	18309324
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IEA
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	ISS
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	17270021
GO:0019903	Function	Protein phosphatase binding	IBA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9388232
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17289999
GO:0043065	Process	Positive regulation of apoptotic process	NAS	14634621
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18402937
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	ISS
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0046031	Process	ADP metabolic process	IEA
GO:0046031	Process	ADP metabolic process	ISS
GO:0046034	Process	ATP metabolic process	IEA
GO:0046034	Process	ATP metabolic process	ISS
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IBA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IMP	20700721
GO:0046931	Process	Pore complex assembly	IDA	19667065, 21081150
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	19593445
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071316	Process	Cellular response to nicotine	IDA	18676776
GO:0071396	Process	Cellular response to lipid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEP	20810912
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IMP	17289999
GO:0097138	Component	BAD-BCL-2 complex	IPI	9463381
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	18852119
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	18676776
GO:0140608	Function	Cysteine-type endopeptidase activator activity	IEA
GO:1902220	Process	Positive regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IEA
GO:2000078	Process	Positive regulation of type B pancreatic cell development	IEA
GO:2000078	Process	Positive regulation of type B pancreatic cell development	ISS

MIM	HGNC	e!Ensembl
603167	936	ENSG00000002330

Q92934

Protein name

Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)

Protein function

Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2 (B

PDB

1G5J , 7Q16

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10514	Bcl-2_BAD	1 → 168	Pro-apoptotic Bcl-2 protein, BAD	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues.

Sequence

MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

Sequence length

168

Interactions

View interactions

BAD (BCL2 associated agonist of cell death)