Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	126792
Gene name	Beta-1,3-galactosyltransferase 6
Gene symbol	B3GALT6
Synonyms (NCBI Gene)	ALGAZEDSP2EDSSPD2SEMDJL1beta3GalT6
Chromosome	1
Chromosome location	1p36.33
Summary	The enzyme encoded by this intronless gene is a beta-1,3-galactosyltransferase found in the medial Golgi apparatus, where it catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal beta-linked galactose moiety. The encod

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments
MIRT813022	hsa-miR-1271	CLIP-seq
MIRT813023	hsa-miR-129-5p	CLIP-seq
MIRT813024	hsa-miR-1343	CLIP-seq
MIRT813025	hsa-miR-141	CLIP-seq
MIRT813026	hsa-miR-1539	CLIP-seq
MIRT813027	hsa-miR-15a	CLIP-seq
MIRT813028	hsa-miR-15b	CLIP-seq
MIRT813029	hsa-miR-16	CLIP-seq
MIRT813030	hsa-miR-182	CLIP-seq
MIRT813031	hsa-miR-190	CLIP-seq
MIRT813032	hsa-miR-190b	CLIP-seq
MIRT813033	hsa-miR-195	CLIP-seq
MIRT813034	hsa-miR-1976	CLIP-seq
MIRT813035	hsa-miR-200a	CLIP-seq
MIRT813036	hsa-miR-2355-3p	CLIP-seq
MIRT813037	hsa-miR-3065-3p	CLIP-seq
MIRT813038	hsa-miR-31	CLIP-seq
MIRT813039	hsa-miR-3193	CLIP-seq
MIRT813040	hsa-miR-3690	CLIP-seq
MIRT813041	hsa-miR-3929	CLIP-seq
MIRT813042	hsa-miR-424	CLIP-seq
MIRT813043	hsa-miR-4254	CLIP-seq
MIRT813044	hsa-miR-4255	CLIP-seq
MIRT813045	hsa-miR-4269	CLIP-seq
MIRT813046	hsa-miR-4273	CLIP-seq
MIRT813047	hsa-miR-4279	CLIP-seq
MIRT813048	hsa-miR-4297	CLIP-seq
MIRT813049	hsa-miR-4419b	CLIP-seq
MIRT813050	hsa-miR-4422	CLIP-seq
MIRT813051	hsa-miR-4424	CLIP-seq
MIRT813052	hsa-miR-4438	CLIP-seq
MIRT813053	hsa-miR-4478	CLIP-seq
MIRT813054	hsa-miR-4677-5p	CLIP-seq
MIRT813055	hsa-miR-4682	CLIP-seq
MIRT813056	hsa-miR-4762-3p	CLIP-seq
MIRT813057	hsa-miR-4766-5p	CLIP-seq
MIRT813058	hsa-miR-4781-5p	CLIP-seq
MIRT813059	hsa-miR-4786-5p	CLIP-seq
MIRT813060	hsa-miR-4790-5p	CLIP-seq
MIRT813061	hsa-miR-486-3p	CLIP-seq
MIRT813062	hsa-miR-490-3p	CLIP-seq
MIRT813063	hsa-miR-497	CLIP-seq
MIRT813064	hsa-miR-503	CLIP-seq
MIRT813065	hsa-miR-5095	CLIP-seq
MIRT813066	hsa-miR-513a-3p	CLIP-seq
MIRT813067	hsa-miR-561	CLIP-seq
MIRT813068	hsa-miR-563	CLIP-seq
MIRT813069	hsa-miR-579	CLIP-seq
MIRT813070	hsa-miR-587	CLIP-seq
MIRT813071	hsa-miR-602	CLIP-seq
MIRT813072	hsa-miR-676	CLIP-seq
MIRT813073	hsa-miR-769-5p	CLIP-seq
MIRT813074	hsa-miR-96	CLIP-seq
MIRT1940344	hsa-miR-1207-5p	CLIP-seq
MIRT1940345	hsa-miR-1228	CLIP-seq
MIRT1940346	hsa-miR-3189-5p	CLIP-seq
MIRT1940347	hsa-miR-342-3p	CLIP-seq
MIRT1940348	hsa-miR-361-3p	CLIP-seq
MIRT1940349	hsa-miR-3660	CLIP-seq
MIRT1940350	hsa-miR-4526	CLIP-seq
MIRT1940351	hsa-miR-4687-5p	CLIP-seq
MIRT1940352	hsa-miR-4726-3p	CLIP-seq
MIRT1940353	hsa-miR-4747-5p	CLIP-seq
MIRT1940354	hsa-miR-4763-3p	CLIP-seq
MIRT813061	hsa-miR-486-3p	CLIP-seq
MIRT1940355	hsa-miR-488	CLIP-seq
MIRT1940356	hsa-miR-508-5p	CLIP-seq
MIRT1940357	hsa-miR-671-5p	CLIP-seq
MIRT2179266	hsa-miR-1264	CLIP-seq
MIRT813024	hsa-miR-1343	CLIP-seq
MIRT813025	hsa-miR-141	CLIP-seq
MIRT2179267	hsa-miR-150	CLIP-seq
MIRT813026	hsa-miR-1539	CLIP-seq
MIRT2179268	hsa-miR-1915	CLIP-seq
MIRT813034	hsa-miR-1976	CLIP-seq
MIRT813035	hsa-miR-200a	CLIP-seq
MIRT2179269	hsa-miR-3124-3p	CLIP-seq
MIRT813039	hsa-miR-3193	CLIP-seq
MIRT2179270	hsa-miR-338-5p	CLIP-seq
MIRT2179271	hsa-miR-340	CLIP-seq
MIRT1940348	hsa-miR-361-3p	CLIP-seq
MIRT2179272	hsa-miR-3692	CLIP-seq
MIRT813047	hsa-miR-4279	CLIP-seq
MIRT813051	hsa-miR-4424	CLIP-seq
MIRT2179273	hsa-miR-4462	CLIP-seq
MIRT2179274	hsa-miR-4668-3p	CLIP-seq
MIRT813055	hsa-miR-4682	CLIP-seq
MIRT2179275	hsa-miR-4713-5p	CLIP-seq
MIRT813058	hsa-miR-4781-5p	CLIP-seq
MIRT813061	hsa-miR-486-3p	CLIP-seq
MIRT813064	hsa-miR-503	CLIP-seq
MIRT2179276	hsa-miR-532-3p	CLIP-seq
MIRT2179277	hsa-miR-548n	CLIP-seq
MIRT2179278	hsa-miR-548t	CLIP-seq
MIRT813067	hsa-miR-561	CLIP-seq
MIRT813068	hsa-miR-563	CLIP-seq
MIRT813071	hsa-miR-602	CLIP-seq
MIRT2179279	hsa-miR-605	CLIP-seq
MIRT2444550	hsa-miR-1236	CLIP-seq
MIRT2444551	hsa-miR-1275	CLIP-seq
MIRT2444552	hsa-miR-151-3p	CLIP-seq
MIRT2444553	hsa-miR-3147	CLIP-seq
MIRT2444554	hsa-miR-4425	CLIP-seq
MIRT2444555	hsa-miR-4665-5p	CLIP-seq
MIRT2464899	hsa-miR-4734	CLIP-seq
MIRT2464900	hsa-miR-604	CLIP-seq
MIRT2464901	hsa-miR-647	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	IMP	29443383
GO:0005797	Component	Golgi medial cisterna	IDA	11551958
GO:0005797	Component	Golgi medial cisterna	IEA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IBA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IEA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IEA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IMP	11551958
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IBA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IEA
GO:0015012	Process	Heparan sulfate proteoglycan biosynthetic process	IMP	23664118
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016758	Function	Hexosyltransferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IMP	29443383
GO:0030203	Process	Glycosaminoglycan metabolic process	TAS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0035250	Function	UDP-galactosyltransferase activity	IDA	11551958
GO:0047220	Function	Galactosylxylosylprotein 3-beta-galactosyltransferase activity	IBA
GO:0047220	Function	Galactosylxylosylprotein 3-beta-galactosyltransferase activity	IEA
GO:0047220	Function	Galactosylxylosylprotein 3-beta-galactosyltransferase activity	IMP	29443383
GO:0047220	Function	Galactosylxylosylprotein 3-beta-galactosyltransferase activity	TAS
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IMP	23664118
GO:0050651	Process	Dermatan sulfate proteoglycan biosynthetic process	IMP	23664118

MIM	HGNC	e!Ensembl
615291	17978	ENSG00000176022

Q96L58

Protein name

Beta-1,3-galactosyltransferase 6 (Beta-1,3-GalTase 6) (Beta3Gal-T6) (Beta3GalT6) (EC 2.4.1.134) (GAG GalTII) (Galactosyltransferase II) (Galactosylxylosylprotein 3-beta-galactosyltransferase) (UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6)

Protein function

Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01762	Galactosyl_T	71 → 260	Galactosyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11551958}.

Sequence

MKLLRRAWRRRAALGLGTLALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAAAFLA
VLVASAPRAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLL
LLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLAELRAREPARRRR
LYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVHYLRLSRDYLRAWHS
EDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLC
KREVQLRLSYVYDWSAPPSQCCQRREGIP

Sequence length

329

Interactions

View interactions

595

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Al-Gazali syndrome	Pathogenic	rs786200938, rs1360531002, rs763080896	RCV004821343 RCV001089597 RCV001089599
B3GALT6-related disorder	Likely pathogenic; Pathogenic	rs778123798, rs786200938	RCV004754826 RCV003944971
Ehlers-Danlos syndrome, spondylodysplastic type, 2	Likely pathogenic; Pathogenic	rs778123798, rs969701761, rs2521960362, rs1638540007, rs786200938, rs1553151294, rs397514720, rs397514721, rs533071750, rs1638566519, rs1638539773	RCV002010337 RCV001378837 RCV002007594 RCV003074887 RCV003780941 RCV004821343 RCV001090033 RCV001853073 RCV001853074 RCV000054397 RCV000054398 RCV001290345 RCV001290346
Spondyloepimetaphyseal dysplasia with joint laxity	Likely pathogenic; Pathogenic	rs778123798, rs969701761, rs2521960362, rs1638540007, rs786200938, rs397514720, rs397514721	RCV002010337 RCV001378837 RCV002007594 RCV003074887 RCV003780941 RCV001853073 RCV001853074 RCV003764726
Spondyloepimetaphyseal dysplasia with joint laxity, type 1, with fractures	Pathogenic	rs1553151294, rs397514723, rs397514724, rs786200943	RCV001090032 RCV000054401 RCV000054402 RCV000054403
Spondyloepimetaphyseal dysplasia with joint laxity, type 1, with or without fractures	Pathogenic; Likely pathogenic	rs786200938, rs1553151294, rs397514718, rs786200939, rs397514719, rs397514720, rs397514723	RCV004821343 RCV000625553 RCV000054390 RCV000054392 RCV000054393 RCV000054394 RCV000054395 RCV003225928
Spondyloepiphyseal dysplasia	Likely pathogenic	rs1239366051	RCV000825512

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	30168613
Connective Tissue Diseases	Associate	23664117, 23664118
Contracture	Associate	23664118
Ehlers Danlos Syndrome	Associate	23664117, 23664118, 25331875
Ehlers Danlos syndrome type 3	Associate	28882145, 31614862
Glaucoma	Associate	26086840
Growth Disorders	Associate	31614862
HEM dysplasia	Associate	23664117, 31614862
Intellectual Disability	Associate	23664118
Joint Diseases	Associate	23664118
Joint Dislocations	Associate	23664117
Joint Instability	Associate	31614862
Kashin Beck Disease	Associate	32517548
Keratoderma Palmoplantar	Associate	30168613
Kyphoscoliosis 1	Associate	23664118
Muscle Hypotonia	Associate	23664117, 31614862
Osteoarthritis	Associate	32517548
Osteoporosis pseudoglioma syndrome	Associate	23664118
Progeroid syndrome neonatal	Associate	23664117
Skin Diseases	Associate	23664117
Spinal Diseases	Associate	23664117
Spondyloepimetaphyseal Dysplasia With Joint Laxity	Associate	23664117
Spondyloepimetaphyseal Dysplasia X Linked	Associate	23664118

B3GALT6 (beta-1,3-galactosyltransferase 6)