ATP1A4 (ATPase Na+/K+ transporting subunit alpha 4)

Gene

• Entrez ID: 480
• Gene name: ATPase Na+/K+ transporting subunit alpha 4
• Gene symbol: ATP1A4
• Synonyms (NCBI Gene): ATP1A1, ATP1AL2
• Chromosome: 1
• Chromosome location: 1q23.2
• Summary: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2177697	hsa-miR-1224-3p	CLIP-seq
MIRT2177698	hsa-miR-204	CLIP-seq
MIRT2177699	hsa-miR-211	CLIP-seq
MIRT2177700	hsa-miR-3157-5p	CLIP-seq
MIRT2177701	hsa-miR-4690-3p	CLIP-seq
MIRT2177702	hsa-miR-4755-5p	CLIP-seq
MIRT2177703	hsa-miR-4793-5p	CLIP-seq
MIRT2177704	hsa-miR-623	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IBA
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IEA
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IGI	16861705
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	ISS
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	TAS	7809153
GO:0005515	Function	Protein binding	IPI	16861705, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	7809153, 30280653
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IBA
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IEA
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IPI	16861705
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	TAS	7809153
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	NAS	30280653
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	7809153
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	TAS	7809153
GO:0006883	Process	Intracellular sodium ion homeostasis	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0008556	Function	P-type potassium transmembrane transporter activity	IEA
GO:0009566	Process	Fertilization	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0016020	Component	Membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019829	Function	ATPase-coupled monoatomic cation transmembrane transporter activity	IGI	16861705
GO:0019900	Function	Kinase binding	ISS
GO:0030003	Process	Intracellular monoatomic cation homeostasis	IEA
GO:0030007	Process	Intracellular potassium ion homeostasis	IBA
GO:0030317	Process	Flagellated sperm motility	IDA	12112599
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	IMP	16861705
GO:0030641	Process	Regulation of cellular pH	IDA	12112599
GO:0035725	Process	Sodium ion transmembrane transport	IGI	16861705
GO:0035725	Process	Sodium ion transmembrane transport	ISS
GO:0036376	Process	Sodium ion export across plasma membrane	IBA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042995	Component	Cell projection	IBA
GO:0045121	Component	Membrane raft	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IGI	16861705
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0097225	Component	Sperm midpiece	IDA	16861705
GO:0097733	Component	Photoreceptor cell cilium	IDA	26373354
GO:0120200	Component	Rod photoreceptor outer segment	IDA	26373354
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902600	Process	Proton transmembrane transport	IBA
GO:1902600	Process	Proton transmembrane transport	TAS	7809153
GO:1990573	Process	Potassium ion import across plasma membrane	IBA

Other IDs

• MIM: 607321
• HGNC: 14073
• e!Ensembl: ENSG00000132681

Protein

• UniProt ID: Q13733
• Protein name: Sodium/potassium-transporting ATPase subunit alpha-4 (Na(+)/K(+) ATPase alpha-4 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-4)
• Protein function: This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassi
• PDB: 8ZYJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00690	Cation_ATPase_N	51 → 119	Cation transporter/ATPase, N-terminus	Domain
  PF00122	E1-E2_ATPase	171 → 362		Family
  PF13246	Cation_ATPase	434 → 528		Family
  PF00689	Cation_ATPase_C	805 → 1014	Cation transporting ATPase, C-terminus	Family

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in testis. Found in very low levels in skeletal muscle. Expressed in mature sperm (at protein level).
• Sequence:

  MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELS
  TKYSVDLTKGHSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCF
  VAYSIQIYFNEEPTKDNLYLSIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVI
  RGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLISAQGCKVDNSSLTGESEPQSRSPDFT
  HENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIASLTSGLAVGQTPIAAEIEHFI
  HLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
  RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADTTEEQTGKTFT
  KSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSVAEMRE
  KNPKVAEIPFNSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDE
  MKEAFQNAYLELGGLGERVLGFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDP
  PRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETAEEVAARLKIPISK
  VDASAAKAIVVHGAELKDIQSKQLDQILQNHPEIVFARTSPQQKLIIVEGCQRLGAVVAV
  TGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKK
  SIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKR
  LPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKY
  LNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVL
  IFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPD
  GWVERETYY

• Sequence length: 1029

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Malignant tumor of esophagus	Benign	rs79938119	RCV005913031

Associations from Text Mining
Disease Name	Relationship Type	References
Testicular Neoplasms	Associate	30924599