Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	476
Gene name Gene Name - the full gene name approved by the HGNC.	ATPase Na+/K+ transporting subunit alpha 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATP1A1
Synonyms (NCBI Gene) Gene synonyms aliases	CMT2DD, HOMGSMR2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients o

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs11540945	T>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs724160008	TCTCAATGTTACTGT>-	Pathogenic	Coding sequence variant, inframe deletion, non coding transcript variant
rs724160010	T>G	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1401759980	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1553190285	T>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1557785499	T>C	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1557785503	G>C	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant

Show/Hide all(169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016292	hsa-miR-193b-3p	Proteomics	21512034
MIRT019537	hsa-miR-340-5p	Sequencing	20371350
MIRT028862	hsa-miR-26b-5p	Microarray	19088304
MIRT052345	hsa-let-7b-5p	CLASH	23622248
MIRT050658	hsa-miR-18a-5p	CLASH	23622248
MIRT050108	hsa-miR-26a-5p	CLASH	23622248
MIRT049192	hsa-miR-92a-3p	CLASH	23622248
MIRT048687	hsa-miR-99a-5p	CLASH	23622248
MIRT048222	hsa-miR-196a-5p	CLASH	23622248
MIRT048123	hsa-miR-197-3p	CLASH	23622248
MIRT047825	hsa-miR-30d-5p	CLASH	23622248
MIRT046260	hsa-miR-23b-3p	CLASH	23622248
MIRT044531	hsa-miR-320a	CLASH	23622248
MIRT041714	hsa-miR-484	CLASH	23622248
MIRT041714	hsa-miR-484	CLASH	23622248
MIRT038912	hsa-miR-93-3p	CLASH	23622248
MIRT719044	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT719043	hsa-miR-6753-5p	HITS-CLIP	19536157
MIRT719042	hsa-miR-1250-5p	HITS-CLIP	19536157
MIRT719041	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT719040	hsa-miR-4746-3p	HITS-CLIP	19536157
MIRT719039	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT719038	hsa-miR-155-3p	HITS-CLIP	19536157
MIRT719037	hsa-miR-3685	HITS-CLIP	19536157
MIRT719036	hsa-miR-384	HITS-CLIP	19536157
MIRT719044	hsa-miR-1911-3p	HITS-CLIP	19536157
MIRT719043	hsa-miR-6753-5p	HITS-CLIP	19536157
MIRT719042	hsa-miR-1250-5p	HITS-CLIP	19536157
MIRT719041	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT719040	hsa-miR-4746-3p	HITS-CLIP	19536157
MIRT719039	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT719038	hsa-miR-155-3p	HITS-CLIP	19536157
MIRT719037	hsa-miR-3685	HITS-CLIP	19536157
MIRT719036	hsa-miR-384	HITS-CLIP	19536157
MIRT806833	hsa-miR-1250	CLIP-seq
MIRT806834	hsa-miR-1298	CLIP-seq
MIRT806835	hsa-miR-147	CLIP-seq
MIRT806836	hsa-miR-2115	CLIP-seq
MIRT806837	hsa-miR-221	CLIP-seq
MIRT806838	hsa-miR-222	CLIP-seq
MIRT806839	hsa-miR-2355-5p	CLIP-seq
MIRT806840	hsa-miR-2467-3p	CLIP-seq
MIRT806841	hsa-miR-3678-3p	CLIP-seq
MIRT806842	hsa-miR-369-3p	CLIP-seq
MIRT806843	hsa-miR-374a	CLIP-seq
MIRT806844	hsa-miR-374b	CLIP-seq
MIRT806845	hsa-miR-3911	CLIP-seq
MIRT806846	hsa-miR-3977	CLIP-seq
MIRT806847	hsa-miR-4286	CLIP-seq
MIRT806848	hsa-miR-431	CLIP-seq
MIRT806849	hsa-miR-4455	CLIP-seq
MIRT806850	hsa-miR-4499	CLIP-seq
MIRT806851	hsa-miR-4651	CLIP-seq
MIRT806852	hsa-miR-4668-3p	CLIP-seq
MIRT806853	hsa-miR-4731-3p	CLIP-seq
MIRT806854	hsa-miR-4801	CLIP-seq
MIRT806855	hsa-miR-516a-3p	CLIP-seq
MIRT806856	hsa-miR-548c-3p	CLIP-seq
MIRT806857	hsa-miR-574-5p	CLIP-seq
MIRT806858	hsa-miR-583	CLIP-seq
MIRT806859	hsa-miR-608	CLIP-seq
MIRT806860	hsa-miR-609	CLIP-seq
MIRT806861	hsa-miR-644	CLIP-seq
MIRT806862	hsa-miR-665	CLIP-seq
MIRT806863	hsa-miR-759	CLIP-seq
MIRT806864	hsa-miR-1180	CLIP-seq
MIRT806835	hsa-miR-147	CLIP-seq
MIRT806840	hsa-miR-2467-3p	CLIP-seq
MIRT806865	hsa-miR-3145-5p	CLIP-seq
MIRT806866	hsa-miR-3163	CLIP-seq
MIRT806841	hsa-miR-3678-3p	CLIP-seq
MIRT806842	hsa-miR-369-3p	CLIP-seq
MIRT806843	hsa-miR-374a	CLIP-seq
MIRT806844	hsa-miR-374b	CLIP-seq
MIRT806845	hsa-miR-3911	CLIP-seq
MIRT806867	hsa-miR-4326	CLIP-seq
MIRT806849	hsa-miR-4455	CLIP-seq
MIRT806868	hsa-miR-4497	CLIP-seq
MIRT806850	hsa-miR-4499	CLIP-seq
MIRT806869	hsa-miR-4528	CLIP-seq
MIRT806851	hsa-miR-4651	CLIP-seq
MIRT806870	hsa-miR-4664-3p	CLIP-seq
MIRT806852	hsa-miR-4668-3p	CLIP-seq
MIRT806853	hsa-miR-4731-3p	CLIP-seq
MIRT806854	hsa-miR-4801	CLIP-seq
MIRT806871	hsa-miR-520d-5p	CLIP-seq
MIRT806872	hsa-miR-524-5p	CLIP-seq
MIRT806856	hsa-miR-548c-3p	CLIP-seq
MIRT806857	hsa-miR-574-5p	CLIP-seq
MIRT806858	hsa-miR-583	CLIP-seq
MIRT806859	hsa-miR-608	CLIP-seq
MIRT806860	hsa-miR-609	CLIP-seq
MIRT806873	hsa-miR-622	CLIP-seq
MIRT806874	hsa-miR-630	CLIP-seq
MIRT806861	hsa-miR-644	CLIP-seq
MIRT806875	hsa-miR-663b	CLIP-seq
MIRT806863	hsa-miR-759	CLIP-seq
MIRT806876	hsa-miR-885-5p	CLIP-seq
MIRT806864	hsa-miR-1180	CLIP-seq
MIRT806833	hsa-miR-1250	CLIP-seq
MIRT806834	hsa-miR-1298	CLIP-seq
MIRT806836	hsa-miR-2115	CLIP-seq
MIRT806837	hsa-miR-221	CLIP-seq
MIRT806838	hsa-miR-222	CLIP-seq
MIRT806839	hsa-miR-2355-5p	CLIP-seq
MIRT806865	hsa-miR-3145-5p	CLIP-seq
MIRT806866	hsa-miR-3163	CLIP-seq
MIRT1938310	hsa-miR-3662	CLIP-seq
MIRT806846	hsa-miR-3977	CLIP-seq
MIRT806847	hsa-miR-4286	CLIP-seq
MIRT806848	hsa-miR-431	CLIP-seq
MIRT806867	hsa-miR-4326	CLIP-seq
MIRT806868	hsa-miR-4497	CLIP-seq
MIRT806850	hsa-miR-4499	CLIP-seq
MIRT806870	hsa-miR-4664-3p	CLIP-seq
MIRT806852	hsa-miR-4668-3p	CLIP-seq
MIRT806853	hsa-miR-4731-3p	CLIP-seq
MIRT806854	hsa-miR-4801	CLIP-seq
MIRT806855	hsa-miR-516a-3p	CLIP-seq
MIRT806871	hsa-miR-520d-5p	CLIP-seq
MIRT806872	hsa-miR-524-5p	CLIP-seq
MIRT806856	hsa-miR-548c-3p	CLIP-seq
MIRT806858	hsa-miR-583	CLIP-seq
MIRT806860	hsa-miR-609	CLIP-seq
MIRT806873	hsa-miR-622	CLIP-seq
MIRT806874	hsa-miR-630	CLIP-seq
MIRT806862	hsa-miR-665	CLIP-seq
MIRT2177674	hsa-miR-1193	CLIP-seq
MIRT806833	hsa-miR-1250	CLIP-seq
MIRT806834	hsa-miR-1298	CLIP-seq
MIRT806835	hsa-miR-147	CLIP-seq
MIRT806836	hsa-miR-2115	CLIP-seq
MIRT806837	hsa-miR-221	CLIP-seq
MIRT806838	hsa-miR-222	CLIP-seq
MIRT806839	hsa-miR-2355-5p	CLIP-seq
MIRT806840	hsa-miR-2467-3p	CLIP-seq
MIRT2177675	hsa-miR-3134	CLIP-seq
MIRT806841	hsa-miR-3678-3p	CLIP-seq
MIRT806845	hsa-miR-3911	CLIP-seq
MIRT806846	hsa-miR-3977	CLIP-seq
MIRT2177676	hsa-miR-4269	CLIP-seq
MIRT806847	hsa-miR-4286	CLIP-seq
MIRT2177677	hsa-miR-4290	CLIP-seq
MIRT806848	hsa-miR-431	CLIP-seq
MIRT806849	hsa-miR-4455	CLIP-seq
MIRT2177678	hsa-miR-4514	CLIP-seq
MIRT806851	hsa-miR-4651	CLIP-seq
MIRT2177679	hsa-miR-4687-5p	CLIP-seq
MIRT2177680	hsa-miR-4692	CLIP-seq
MIRT2177681	hsa-miR-4742-5p	CLIP-seq
MIRT806855	hsa-miR-516a-3p	CLIP-seq
MIRT806871	hsa-miR-520d-5p	CLIP-seq
MIRT806872	hsa-miR-524-5p	CLIP-seq
MIRT2177682	hsa-miR-548ac	CLIP-seq
MIRT2177683	hsa-miR-548ae	CLIP-seq
MIRT2177684	hsa-miR-548aj	CLIP-seq
MIRT2177685	hsa-miR-548am	CLIP-seq
MIRT2177686	hsa-miR-548d-3p	CLIP-seq
MIRT2177687	hsa-miR-548x	CLIP-seq
MIRT2177688	hsa-miR-548z	CLIP-seq
MIRT806857	hsa-miR-574-5p	CLIP-seq
MIRT806858	hsa-miR-583	CLIP-seq
MIRT806859	hsa-miR-608	CLIP-seq
MIRT806860	hsa-miR-609	CLIP-seq
MIRT2177689	hsa-miR-616	CLIP-seq
MIRT806861	hsa-miR-644	CLIP-seq
MIRT806875	hsa-miR-663b	CLIP-seq
MIRT806862	hsa-miR-665	CLIP-seq
MIRT806863	hsa-miR-759	CLIP-seq

Show/Hide all(100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0002028	Process	Regulation of sodium ion transport	ISS
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IBA
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IDA	10636900, 19542013
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IEA
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	IGI	18052210
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	ISS
GO:0005391	Function	P-type sodium:potassium-exchanging transporter activity	TAS	1975705
GO:0005515	Function	Protein binding	IPI	11027149, 15671290, 16730713, 17220478, 18504258, 21228272, 21278788, 22084111, 25012180, 30021884, 33961781, 35271311, 35803952
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005794	Component	Golgi apparatus	ISS
GO:0005886	Component	Plasma membrane	HDA	16791210
GO:0005886	Component	Plasma membrane	IDA	7711835, 18522992
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IGI	19751721
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IBA
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IDA	10636900, 19542013
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IEA
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IGI	18052210
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IPI	35803952
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	ISS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	TAS	1975705
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006883	Process	Intracellular sodium ion homeostasis	IBA
GO:0006883	Process	Intracellular sodium ion homeostasis	IDA	10636900, 19542013
GO:0006883	Process	Intracellular sodium ion homeostasis	ISO
GO:0007231	Process	Osmosensory signaling pathway	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008556	Function	P-type potassium transmembrane transporter activity	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	NAS	24688018
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016020	Component	Membrane	TAS	1975705
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IDA	11193188
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	11193188
GO:0016791	Function	Phosphatase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	10636900
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030003	Process	Intracellular monoatomic cation homeostasis	IEA
GO:0030007	Process	Intracellular potassium ion homeostasis	IBA
GO:0030007	Process	Intracellular potassium ion homeostasis	IDA	10636900, 19542013
GO:0030007	Process	Intracellular potassium ion homeostasis	ISO
GO:0030315	Component	T-tubule	IEA
GO:0030315	Component	T-tubule	IGI	19751721
GO:0030424	Component	Axon	IEA
GO:0030955	Function	Potassium ion binding	ISS
GO:0031090	Component	Organelle membrane	IGI	19751721
GO:0031402	Function	Sodium ion binding	ISS
GO:0031947	Process	Negative regulation of glucocorticoid biosynthetic process	IEA
GO:0032991	Component	Protein-containing complex	IDA	22797923
GO:0035725	Process	Sodium ion transmembrane transport	IGI	18052210
GO:0036126	Component	Sperm flagellum	IDA	16861705
GO:0036376	Process	Sodium ion export across plasma membrane	IBA
GO:0036376	Process	Sodium ion export across plasma membrane	IDA	10636900, 19542013
GO:0036376	Process	Sodium ion export across plasma membrane	ISO
GO:0036376	Process	Sodium ion export across plasma membrane	ISS
GO:0042383	Component	Sarcolemma	IBA
GO:0042383	Component	Sarcolemma	IEA
GO:0042383	Component	Sarcolemma	ISS
GO:0042470	Component	Melanosome	IEA
GO:0042995	Component	Cell projection	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045822	Process	Negative regulation of heart contraction	IEA
GO:0045823	Process	Positive regulation of heart contraction	IEA
GO:0045989	Process	Positive regulation of striated muscle contraction	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0051087	Function	Protein-folding chaperone binding	IPI	10636900
GO:0055078	Process	Sodium ion homeostasis	IEA
GO:0055119	Process	Relaxation of cardiac muscle	TAS	23224879
GO:0060047	Process	Heart contraction	IEA
GO:0060342	Component	Photoreceptor inner segment membrane	ISS	26373354
GO:0070062	Component	Extracellular exosome	HDA	12519789, 19199708, 20458337
GO:0071383	Process	Cellular response to steroid hormone stimulus	IDA	11546672
GO:0071805	Process	Potassium ion transmembrane transport	IGI	18052210
GO:0086002	Process	Cardiac muscle cell action potential involved in contraction	TAS	23224879
GO:0086009	Process	Membrane repolarization	IDA	19542013
GO:0086013	Process	Membrane repolarization during cardiac muscle cell action potential	IC	19542013
GO:0086064	Process	Cell communication by electrical coupling involved in cardiac conduction	TAS	19683723
GO:1902600	Process	Proton transmembrane transport	IBA
GO:1902600	Process	Proton transmembrane transport	NAS	24688018
GO:1903416	Process	Response to glycoside	IDA	11546672
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1990239	Function	Steroid hormone binding	IDA	14742675
GO:1990573	Process	Potassium ion import across plasma membrane	IBA
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	10636900, 19542013
GO:1990573	Process	Potassium ion import across plasma membrane	ISO
GO:1990573	Process	Potassium ion import across plasma membrane	ISS

MIM	HGNC	e!Ensembl
182310	799	ENSG00000163399

Protein

UniProt ID

P05023

Protein name

Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)

Protein function

This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassi

PDB

7E1Z , 7E20 , 7E21

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00690	Cation_ATPase_N	43 → 111	Cation transporter/ATPase, N-terminus	Domain
PF00122	E1-E2_ATPase	163 → 354		Family
PF13246	Cation_ATPase	426 → 521		Family
PF00689	Cation_ATPase_C	799 → 1008	Cation transporting ATPase, C-terminus	Family

Sequence

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY

Sequence length

1023

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth disease type 2A2, charcot-marie-tooth disease, axonal, type 2dd	rs1553192091, rs1553192086, rs1553190285	N/A
Hypomagnesemia	Hypomagnesemia, seizures, and intellectual disability 2	rs1557785499, rs1557785503, rs781629728, rs1570980551	N/A
Aldosterone-Producing Adrenal Cortex Adenoma	aldosterone-producing adrenal cortex adenoma	rs724160008, rs11540945, rs724160010	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Neurodevelopmental Disorders	neurodevelopmental disorder	N/A	N/A	GenCC

Show/Hide Text Mining Associations (53)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
ACTH Secreting Pituitary Adenoma	Associate	26743443
Adenoma	Associate	34681640
Adrenocortical Adenoma	Associate	26765578, 31789380, 34681640
Adrenocortical Carcinoma	Associate	34681640
Alcoholic Neuropathy	Associate	35110381
Alzheimer Disease	Associate	38212844
Anxiety	Associate	27487491
Anxiety Disorders	Associate	27487491
Carcinoma Hepatocellular	Associate	20460749, 26334094
Carcinoma Hepatocellular	Stimulate	33868261
Carcinoma Pancreatic Ductal	Associate	35618735
Cardiomyopathies	Associate	32631246
Cerebellar Ataxia	Associate	35110381
Charcot Marie Tooth Disease	Associate	36738336
Charcot Marie Tooth disease Type 4A	Associate	36738336
Cushing Syndrome	Associate	26743443
Deafness	Associate	37558483
Demyelinating Diseases	Associate	36738336
Depressive Disorder Major	Inhibit	27487491
Essential Hypertension	Associate	17446437
Essential Tremor	Associate	17446437
Fuchs' Endothelial Dystrophy	Inhibit	29698634
Glioblastoma	Associate	22575386
Glioma	Associate	37901992
Hearing Disorders	Associate	37558483
Hearing Loss Sensorineural	Associate	37558483
Hearing Loss Unilateral	Associate	40302475
Heart Diseases	Associate	24427266
Hereditary Sensory and Autonomic Neuropathy Type Ie	Associate	35110381
Herpes Zoster	Associate	25776071
Hyperaldosteronism	Associate	24082052, 24866132, 25776071, 25906099, 26066391, 26252618, 26351028, 26743443, 26807823, 27729216, 30085035, 30739536, 32516371, 33677921, 33796077, 34681640, 35257799, 40302475 View all (3 more)
Hypertension	Associate	17446437
Inflammation	Associate	36871182
Intellectual Disability	Associate	30388404, 35110381, 36738336
Kidney Calculi	Associate	36871182
Kidney Neoplasms	Associate	36189312
Leukemia Monocytic Acute	Associate	37904054
Leukemia Myeloid Acute	Associate	37904054
Migraine with Aura	Associate	35110381
Muscle Spasticity	Associate	35110381
Neointima	Associate	36871182
Neoplasm Metastasis	Associate	35618735
Neoplasms	Associate	20460749, 35618735
Nephrolithiasis	Associate	36871182
Nervous System Diseases	Associate	36738336
Paraplegia	Associate	35110381, 36738336
Peripheral Nervous System Diseases	Associate	35110381, 36738336, 37558483
Prostatic Neoplasms	Associate	27701467
Seizures	Associate	30388404, 35110381
Sleep Wake Disorders	Associate	35110381
Small Cell Lung Carcinoma	Associate	30183476
Thyroid Neoplasms	Associate	32377223
Vascular Diseases	Associate	17446437

ATP1A1 (ATPase Na+/K+ transporting subunit alpha 1)