Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1388
Gene name Gene Name - the full gene name approved by the HGNC.
Activating transcription factor 6 beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATF6B
Synonyms (NCBI Gene) Gene synonyms aliases
ATF6beta, CREB-RP, CREBL1, G13
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004191 hsa-miR-197-3p Microarray 16822819
MIRT645450 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT645449 hsa-miR-548ah-3p HITS-CLIP 23824327
MIRT645448 hsa-miR-548aj-3p HITS-CLIP 23824327
MIRT645447 hsa-miR-548am-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 11256944
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11256944
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600984 2349 ENSG00000213676
Protein
UniProt ID Q99941
Protein name Cyclic AMP-dependent transcription factor ATF-6 beta (cAMP-dependent transcription factor ATF-6 beta) (Activating transcription factor 6 beta) (ATF6-beta) (Protein G13) (cAMP response element-binding protein-related protein) (Creb-rp) (cAMP-responsive ele
Protein function [Cyclic AMP-dependent transcription factor ATF-6 beta]: Precursor of the transcription factor form (Processed cyclic AMP-dependent transcription factor ATF-6 beta), which is embedded in the endoplasmic reticulum membrane (PubMed:11256944). Endop
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 323 389 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11256944}.
Sequence
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELK
LGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP
Sequence length 703
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neuroticism Neuroticism N/A N/A GWAS
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 29530003, 35617355
Lupus Erythematosus Systemic Associate 19851445, 21695597
Obesity Associate 29459183
Pregnancy Complications Associate 26648175