Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	1386
Gene name	Activating transcription factor 2
Gene symbol	ATF2
Synonyms (NCBI Gene)	CRE-BP1CREB-2CREB2HB16TREB7
Chromosome	2
Chromosome location	2q31.1
Summary	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This prote

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016080	hsa-miR-374b-5p	Sequencing	20371350
MIRT019034	hsa-miR-335-5p	Microarray	18185580
MIRT031029	hsa-miR-21-5p	Microarray	18591254
MIRT031297	hsa-miR-19b-3p	Sequencing	20371350
MIRT051336	hsa-miR-15a-5p	CLASH	23622248
MIRT732803	hsa-miR-26b-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32476275
MIRT733466	hsa-miR-451a	Western blottingImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCR	32710569
MIRT804238	hsa-miR-1226	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT804242	hsa-miR-3591-3p	CLIP-seq
MIRT804243	hsa-miR-3609	CLIP-seq
MIRT804244	hsa-miR-3663-3p	CLIP-seq
MIRT804245	hsa-miR-3941	CLIP-seq
MIRT804246	hsa-miR-4477a	CLIP-seq
MIRT804247	hsa-miR-4643	CLIP-seq
MIRT804248	hsa-miR-466	CLIP-seq
MIRT804249	hsa-miR-4672	CLIP-seq
MIRT804250	hsa-miR-4729	CLIP-seq
MIRT804251	hsa-miR-4789-3p	CLIP-seq
MIRT804252	hsa-miR-545	CLIP-seq
MIRT804253	hsa-miR-548ah	CLIP-seq
MIRT804254	hsa-miR-548n	CLIP-seq
MIRT804255	hsa-miR-548t	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT804258	hsa-miR-634	CLIP-seq
MIRT804259	hsa-miR-802	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT2177152	hsa-miR-502-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT2480442	hsa-miR-3688-3p	CLIP-seq
MIRT2480443	hsa-miR-4261	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT2480444	hsa-miR-4694-3p	CLIP-seq
MIRT2480445	hsa-miR-4738-3p	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT2480446	hsa-miR-522	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
NR3C1	Repression	17016446
RB1	Unknown	7702750
SP1	Unknown	2145272

109

Show/Hide all (109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	EXP	11231009
GO:0000165	Process	MAPK cascade	IEA
GO:0000785	Component	Chromatin	IDA	23729669
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	2516827
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IC	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731, 18671972, 19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001865	Process	NK T cell differentiation	IEA
GO:0001889	Process	Liver development	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003360	Process	Brainstem development	IEA
GO:0003418	Process	Growth plate cartilage chondrocyte differentiation	IEA
GO:0003419	Process	Growth plate cartilage chondrocyte proliferation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	8440710, 9748258, 10327051, 15105425, 15916964, 16511568, 18397884, 20102225, 20116378, 20195357, 20211142, 20511396, 22439931, 23661758, 24705354, 25416956, 25609649, 26496610, 28514442, 31515488, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	EXP	11231009
GO:0005634	Component	Nucleus	IDA	8798441, 18397884, 19861239, 21098032, 22304920
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758, 28186491
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22304920
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	22304920
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	22304920
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	19861239
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758, 28186491
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006970	Process	Response to osmotic stress	IDA	21098032
GO:0006974	Process	DNA damage response	IDA	22304920
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	15916964
GO:0007033	Process	Vacuole organization	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0007507	Process	Heart development	IEA
GO:0008140	Function	CAMP response element binding protein binding	IDA	19861239
GO:0008270	Function	Zinc ion binding	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010485	Function	Histone H4 acetyltransferase activity	IDA	10821277
GO:0010628	Process	Positive regulation of gene expression	IMP	28977001
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	28977001
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	17267404
GO:0019901	Function	Protein kinase binding	IPI	21098032
GO:0021742	Process	Abducens nucleus development	IEA
GO:0021743	Process	Hypoglossal nucleus development	IEA
GO:0021754	Process	Facial nucleus development	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IMP	15916964
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035497	Function	CAMP response element binding	IBA
GO:0035497	Function	CAMP response element binding	IDA	19861239, 23729669
GO:0035497	Function	CAMP response element binding	IEA
GO:0035861	Component	Site of double-strand break	IDA	15916964
GO:0035861	Component	Site of double-strand break	IEA
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042802	Function	Identical protein binding	IPI	16511568, 23661758
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043522	Function	Leucine zipper domain binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044013	Function	Histone H2B acetyltransferase activity	IDA	10821277
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IDA	10821277
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731, 17267404, 18671972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	10821277
GO:0060052	Process	Neurofilament cytoskeleton organization	IEA
GO:0060245	Process	Detection of cell density	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19861239
GO:0072740	Process	Cellular response to anisomycin	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	11231009
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758, 28186491
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0110024	Process	Positive regulation of cardiac muscle myoblast proliferation	IDA	22982025
GO:1902110	Process	Positive regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	22304920
GO:1902562	Component	H4 histone acetyltransferase complex	IDA	10821277
GO:1902742	Process	Apoptotic process involved in development	IEA
GO:1990144	Process	Intrinsic apoptotic signaling pathway in response to hypoxia	IEA
GO:1990253	Process	Cellular response to leucine starvation	IDA	17267404
GO:1990253	Process	Cellular response to leucine starvation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	17267404
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
123811	784	ENSG00000115966

P15336

Protein name

Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response el

Protein function

Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequ

PDB

1BHI , 1T2K , 4H36 , 6ZQS , 6ZR5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	350 → 413	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with more abundant expression in the brain.

Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS

Sequence length

505

Interactions

View interactions

ATF2 (activating transcription factor 2)