Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1386
Gene name Gene Name - the full gene name approved by the HGNC.	Activating transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATF2
Synonyms (NCBI Gene) Gene synonyms aliases	CRE-BP1, CREB-2, CREB2, HB16, TREB7
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This prote

Show/Hide all(108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016080	hsa-miR-374b-5p	Sequencing	20371350
MIRT019034	hsa-miR-335-5p	Microarray	18185580
MIRT031029	hsa-miR-21-5p	Microarray	18591254
MIRT031297	hsa-miR-19b-3p	Sequencing	20371350
MIRT051336	hsa-miR-15a-5p	CLASH	23622248
MIRT732803	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32476275
MIRT733466	hsa-miR-451a	Western blotting, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR	32710569
MIRT804238	hsa-miR-1226	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT804242	hsa-miR-3591-3p	CLIP-seq
MIRT804243	hsa-miR-3609	CLIP-seq
MIRT804244	hsa-miR-3663-3p	CLIP-seq
MIRT804245	hsa-miR-3941	CLIP-seq
MIRT804246	hsa-miR-4477a	CLIP-seq
MIRT804247	hsa-miR-4643	CLIP-seq
MIRT804248	hsa-miR-466	CLIP-seq
MIRT804249	hsa-miR-4672	CLIP-seq
MIRT804250	hsa-miR-4729	CLIP-seq
MIRT804251	hsa-miR-4789-3p	CLIP-seq
MIRT804252	hsa-miR-545	CLIP-seq
MIRT804253	hsa-miR-548ah	CLIP-seq
MIRT804254	hsa-miR-548n	CLIP-seq
MIRT804255	hsa-miR-548t	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT804258	hsa-miR-634	CLIP-seq
MIRT804259	hsa-miR-802	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT2177152	hsa-miR-502-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT2480442	hsa-miR-3688-3p	CLIP-seq
MIRT2480443	hsa-miR-4261	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT2480444	hsa-miR-4694-3p	CLIP-seq
MIRT2480445	hsa-miR-4738-3p	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT2480446	hsa-miR-522	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
NR3C1	Repression	17016446
RB1	Unknown	7702750
SP1	Unknown	2145272

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	23729669
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	2516827
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IC	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731, 18671972, 19861239
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0004402	Function	Histone acetyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	8440710, 9748258, 10327051, 15105425, 15916964, 16511568, 18397884, 20102225, 20116378, 20195357, 20511396, 22439931, 24705354, 25416956, 25609649, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	8798441, 18397884, 19861239, 21098032, 22304920
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22304920
GO:0005741	Component	Mitochondrial outer membrane	IDA	22304920
GO:0006355	Process	Regulation of transcription, DNA-templated	IMP	22304920
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	19861239
GO:0006970	Process	Response to osmotic stress	IDA	21098032
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	22304920
GO:0006974	Process	Cellular response to DNA damage stimulus	IMP	15916964
GO:0008140	Function	CAMP response element binding protein binding	IDA	19861239
GO:0009414	Process	Response to water deprivation	IEA
GO:0010485	Function	H4 histone acetyltransferase activity	IDA	10821277
GO:0010628	Process	Positive regulation of gene expression	IMP	28977001
GO:0016525	Process	Negative regulation of angiogenesis	IMP	28977001
GO:0019901	Function	Protein kinase binding	IPI	21098032
GO:0031573	Process	Intra-S DNA damage checkpoint	IMP	15916964
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0035497	Function	CAMP response element binding	IBA	21873635
GO:0035497	Function	CAMP response element binding	IDA	19861239, 23729669
GO:0035861	Component	Site of double-strand break	IDA	15916964
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043967	Process	Histone H4 acetylation	IDA	10821277
GO:0043969	Process	Histone H2B acetylation	IDA	10821277
GO:0044013	Function	H2B histone acetyltransferase activity	IDA	10821277
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731, 18671972
GO:0046872	Function	Metal ion binding	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	10821277
GO:0060612	Process	Adipose tissue development	IEA
GO:0097186	Process	Amelogenesis	IEA
GO:0110024	Process	Positive regulation of cardiac muscle myoblast proliferation	IDA	22982025
GO:1902110	Process	Positive regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	22304920
GO:1902562	Component	H4 histone acetyltransferase complex	IDA	10821277
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
123811	784	ENSG00000115966

Protein

UniProt ID

P15336

Protein name

Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response el

Protein function

Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequ

PDB

1BHI , 1T2K , 4H36 , 6ZQS , 6ZR5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	350 → 413	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with more abundant expression in the brain.

Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS

Sequence length

505

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Schizophrenia	Schizophrenia			GWAS

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	29935546
Arteriovenous Fistula	Associate	34987128
Arthritis Rheumatoid	Associate	29577053
Atherosclerosis	Associate	17244683
Autoimmune Diseases	Associate	15185015
Bipolar Disorder	Associate	18189280
Breast Neoplasms	Associate	19331149, 26537518, 26729199, 27592113, 28618963
Breast Neoplasms	Inhibit	33198803
Burkitt Lymphoma	Associate	15185015
Carcinogenesis	Associate	35394699, 35692887
Carcinoma Hepatocellular	Associate	29693700, 35394699, 37215991
Carcinoma Non Small Cell Lung	Associate	25359574, 26935060, 30229828, 30229848
Carcinoma Non Small Cell Lung	Stimulate	35692887
Carcinoma Renal Cell	Associate	28429654
Cardiotoxicity	Associate	36204517
Cholangiocarcinoma	Associate	25502636
Colitis Ulcerative	Associate	24118792
Colorectal Neoplasms	Associate	23737956, 29453334, 36200182, 37237279, 37816820
Constriction Pathologic	Associate	34987128
Diabetes Mellitus Type 2	Associate	32993798
Endometrial Neoplasms	Associate	20087603
Endometriosis	Associate	27041028
Glioblastoma	Associate	27588402
Glioma	Associate	17012236
Head and Neck Neoplasms	Associate	21990224
Hemoglobinuria Paroxysmal	Associate	28630090
Hypoxia Brain	Associate	10212278
Infections	Associate	11909956, 17617610
Inflammation	Associate	20519498, 31212975
Insulinoma	Associate	16869889
Intervertebral Disc Degeneration	Associate	35784175
Intervertebral disc disease	Associate	35784175
Kashin Beck Disease	Associate	23866832
Leukemia Myeloid Acute	Associate	28203711
Lung Neoplasms	Associate	21901137, 25359574, 30229848
Lymphoma	Associate	33883344
Lymphoma B Cell	Associate	33883344
Lymphoma Large B Cell Diffuse	Associate	26747248
Melanoma	Associate	10318823, 18397884, 19884546, 22304920, 25728676, 38294692
Multiple Myeloma	Associate	26433312
Multiple Sclerosis	Associate	21152067
Neoplasms	Associate	19331149, 21990224, 22919439, 35394699, 37237279
Neoplasms	Inhibit	22304920, 33198803
Neurodegenerative Diseases	Associate	32993798
Osteoarthritis	Associate	23866832
Osteoporosis	Associate	30809532
Osteosarcoma	Associate	30816442, 32587775
Pancreatic Neoplasms	Associate	22109562
Plaque Atherosclerotic	Stimulate	17244683
Pre Eclampsia	Associate	31075732
Prostatic Neoplasms	Associate	18397884, 19047143, 29996942
Skin Neoplasms	Inhibit	22304920
Squamous Cell Carcinoma of Head and Neck	Associate	21990224
Stomach Neoplasms	Associate	34195276
Thyroid Cancer Papillary	Associate	33724979
Tuberculosis Multidrug Resistant	Associate	28429654
Uterine Cervical Neoplasms	Associate	31204513
Vascular Diseases	Associate	34983301
Wolf Hirschhorn Syndrome	Stimulate	35394699

ATF2 (activating transcription factor 2)