ASNS (asparagine synthetase (glutamine-hydrolyzing))

Gene
Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
440
Gene name Gene Name - the full gene name approved by the HGNC.
Asparagine synthetase (glutamine-hydrolyzing)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ASNS
Synonyms (NCBI Gene) Gene synonyms aliases
ASNSD, TS11
Disease Acronyms (UniProt) Disease acronyms from UniProt database
ASNSD
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. A
miRNA miRNA information provided by mirtarbase database.
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all(18)
miRTarBase ID miRNA Experiments Reference
MIRT020723 hsa-miR-155-5p Proteomics 18668040
MIRT029495 hsa-miR-26b-5p Microarray 19088304
MIRT031665 hsa-miR-16-5p Proteomics 18668040
MIRT050820 hsa-miR-17-5p CLASH 23622248
MIRT050405 hsa-miR-23a-3p CLASH 23622248
Transcription factors
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all(7)
Transcription factor Regulation Reference
ATF3 Activation 12881527
ATF3 Unknown 15385533
ATF4 Activation 11960987;16164412;17276738
ATF4 Unknown 15385533;23403946
CEBPB Unknown 15385533
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0001889 Process Liver development IEA
GO:0004066 Function Asparagine synthase (glutamine-hydrolyzing) activity IBA 21873635
GO:0004066 Function Asparagine synthase (glutamine-hydrolyzing) activity IDA 2564390, 2569668, 2573597, 2886907, 16023613
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Transcription factors Other IDs Associated diseases
MIM HGNC e!Ensembl
108370 753 ENSG00000070669
Protein
Gene SNPs Transcription factors Other IDs Associated diseases
UniProt ID P08243
Protein name Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Cell cycle control protein TS11) (Glutamine-dependent asparagine synthetase)
PDB 6GQ3 , 8SUE , 9B6C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13537 GATase_7 47 → 166 Glutamine amidotransferase domain Domain
PF00733 Asn_synthase 234 → 395 Asparagine synthase Domain
PF00733 Asn_synthase 381 → 547 Asparagine synthase Domain
Sequence 
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA
Sequence length 561
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Congenital Microcephaly congenital microcephaly - severe encephalopathy - progressive cerebral atrophy syndrome GenCC
Show/Hide Text Mining Associations (29)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31551255
Atrophy Associate 26318253
Barrett Esophagus Associate 33491460
Blindness Cortical Associate 27422383
Brain Diseases Associate 25227173, 32481472
Carcinoma Hepatocellular Inhibit 28629319
Carcinoma Hepatocellular Associate 28629319, 30176945, 32746792
Carcinoma Pancreatic Ductal Associate 37814011
Diabetic Foot Associate 38287255
Drug Hypersensitivity Associate 24907114