Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	335
Gene name Gene Name - the full gene name approved by the HGNC.	Apolipoprotein A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	APOA1
Synonyms (NCBI Gene) Gene synonyms aliases	AMYLD3, HPALP2, apo(a)
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AMYLD3
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues t

Show/Hide all(63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT483217	hsa-miR-3179	PAR-CLIP	20371350
MIRT483216	hsa-miR-3202	PAR-CLIP	20371350
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT483217	hsa-miR-3179	PAR-CLIP	20371350
MIRT483216	hsa-miR-3202	PAR-CLIP	20371350
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT528210	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT528209	hsa-miR-1305	PAR-CLIP	22012620
MIRT528208	hsa-miR-6722-5p	PAR-CLIP	22012620
MIRT499158	hsa-miR-181d-3p	PAR-CLIP	24398324
MIRT483217	hsa-miR-3179	PAR-CLIP	24398324
MIRT499157	hsa-miR-3663-3p	PAR-CLIP	24398324
MIRT483216	hsa-miR-3202	PAR-CLIP	24398324
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	24398324
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	24398324
MIRT483217	hsa-miR-3179	PAR-CLIP	23592263
MIRT483216	hsa-miR-3202	PAR-CLIP	23592263
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT483217	hsa-miR-3179	PAR-CLIP	23592263
MIRT483216	hsa-miR-3202	PAR-CLIP	23592263
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT449578	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT449577	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT449576	hsa-miR-4740-3p	PAR-CLIP	22100165
MIRT449575	hsa-miR-3158-5p	PAR-CLIP	22100165
MIRT449574	hsa-miR-558	PAR-CLIP	22100165
MIRT449573	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT483217	hsa-miR-3179	PAR-CLIP	20371350
MIRT483216	hsa-miR-3202	PAR-CLIP	20371350
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT483217	hsa-miR-3179	PAR-CLIP	20371350
MIRT483216	hsa-miR-3202	PAR-CLIP	20371350
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT528210	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT528209	hsa-miR-1305	PAR-CLIP	22012620
MIRT528208	hsa-miR-6722-5p	PAR-CLIP	22012620
MIRT499158	hsa-miR-181d-3p	PAR-CLIP	24398324
MIRT483217	hsa-miR-3179	PAR-CLIP	24398324
MIRT499157	hsa-miR-3663-3p	PAR-CLIP	24398324
MIRT483216	hsa-miR-3202	PAR-CLIP	24398324
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	24398324
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	24398324
MIRT483217	hsa-miR-3179	PAR-CLIP	23592263
MIRT483216	hsa-miR-3202	PAR-CLIP	23592263
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT483217	hsa-miR-3179	PAR-CLIP	23592263
MIRT483216	hsa-miR-3202	PAR-CLIP	23592263
MIRT483214	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT483215	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT449578	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT449577	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT449576	hsa-miR-4740-3p	PAR-CLIP	22100165
MIRT449575	hsa-miR-3158-5p	PAR-CLIP	22100165
MIRT449574	hsa-miR-558	PAR-CLIP	22100165
MIRT449573	hsa-miR-6869-5p	PAR-CLIP	22100165
MIRT756031	hsa-miR-520h	Luciferase reporter assay, qRT-PCR	34555726

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
FOXA2	Unknown	7961760
GATA6	Unknown	14659877
HNF4A	Unknown	7961760
SP1	Unknown	10829013

Show/Hide all(135)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0001540	Function	Amyloid-beta binding	IDA	11297421
GO:0001540	Function	Amyloid-beta binding	IPI	9211985
GO:0001932	Process	Regulation of protein phosphorylation	IEA
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0002576	Process	Platelet degranulation	TAS
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	12458630
GO:0005102	Function	Signaling receptor binding	IPI	27477018
GO:0005515	Function	Protein binding	IPI	1587806, 11297421, 11991719, 12084722, 12917409, 15174051, 17676061, 17786215, 19758344, 23719382, 25241761, 25416956, 25910212, 28565870, 28887769, 30458687, 31270237, 32296183, 32814053
GO:0005543	Function	Phospholipid binding	IBA	21873635
GO:0005543	Function	Phospholipid binding	IDA	12810715
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 20551380, 22664934
GO:0005615	Component	Extracellular space	IDA	19433579
GO:0005615	Component	Extracellular space	ISS	22261194
GO:0005634	Component	Nucleus	IEA
GO:0005769	Component	Early endosome	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006656	Process	Phosphatidylcholine biosynthetic process	IDA	4335615
GO:0006695	Process	Cholesterol biosynthetic process	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	23726972
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	16443932
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	23726972
GO:0007584	Process	Response to nutrient	IEA
GO:0008035	Function	High-density lipoprotein particle binding	IEA
GO:0008203	Process	Cholesterol metabolic process	IMP	15464323
GO:0008211	Process	Glucocorticoid metabolic process	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	21571275
GO:0010873	Process	Positive regulation of cholesterol esterification	IBA	21873635
GO:0010873	Process	Positive regulation of cholesterol esterification	IDA	4335615
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	27472885
GO:0010898	Process	Positive regulation of triglyceride catabolic process	IBA	21873635
GO:0010903	Process	Negative regulation of very-low-density lipoprotein particle remodeling	IDA	14967812
GO:0014012	Process	Peripheral nervous system axon regeneration	IEA
GO:0015485	Function	Cholesterol binding	IBA	21873635
GO:0015485	Function	Cholesterol binding	IDA	15464323
GO:0018158	Process	Protein oxidation	IDA	12576517
GO:0018206	Process	Peptidyl-methionine modification	IDA	12576517
GO:0019216	Process	Regulation of lipid metabolic process	TAS
GO:0019899	Function	Enzyme binding	IPI	1587806
GO:0019915	Process	Lipid storage	IEA
GO:0030139	Component	Endocytic vesicle	IDA	14747463
GO:0030300	Process	Regulation of intestinal cholesterol absorption	IBA	21873635
GO:0030301	Process	Cholesterol transport	IDA	10559507
GO:0030325	Process	Adrenal gland development	IEA
GO:0031072	Function	Heat shock protein binding	IPI	11027668
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031210	Function	Phosphatidylcholine binding	IBA	21873635
GO:0031410	Component	Cytoplasmic vesicle	IDA	14703508
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IDA	16443932
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	12458630
GO:0033344	Process	Cholesterol efflux	IBA	21873635
GO:0033344	Process	Cholesterol efflux	IDA	11162594, 14703508, 15358760, 16443932, 21481393
GO:0033344	Process	Cholesterol efflux	IMP	12202492
GO:0033700	Process	Phospholipid efflux	IBA	21873635
GO:0033700	Process	Phospholipid efflux	IDA	11162594, 14703508
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	21571275
GO:0034190	Function	Apolipoprotein receptor binding	IPI	11162594
GO:0034191	Function	Apolipoprotein A-I receptor binding	IPI	16443932
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	17154273
GO:0034362	Component	Low-density lipoprotein particle	IEA
GO:0034363	Component	Intermediate-density lipoprotein particle	IEA
GO:0034364	Component	High-density lipoprotein particle	IBA	21873635
GO:0034364	Component	High-density lipoprotein particle	IDA	210174, 3104518, 9211985, 15464323, 21571275
GO:0034364	Component	High-density lipoprotein particle	TAS	27477018
GO:0034365	Component	Discoidal high-density lipoprotein particle	IEA
GO:0034366	Component	Spherical high-density lipoprotein particle	IDA	16682745
GO:0034371	Process	Chylomicron remodeling	TAS
GO:0034372	Process	Very-low-density lipoprotein particle remodeling	IBA	21873635
GO:0034375	Process	High-density lipoprotein particle remodeling	IC	4335615
GO:0034375	Process	High-density lipoprotein particle remodeling	IDA	21481393
GO:0034375	Process	High-density lipoprotein particle remodeling	TAS
GO:0034378	Process	Chylomicron assembly	TAS
GO:0034380	Process	High-density lipoprotein particle assembly	IBA	21873635
GO:0034380	Process	High-density lipoprotein particle assembly	IDA	190223
GO:0034380	Process	High-density lipoprotein particle assembly	TAS
GO:0034384	Process	High-density lipoprotein particle clearance	IC	12651854
GO:0034384	Process	High-density lipoprotein particle clearance	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IDA	23726972
GO:0042157	Process	Lipoprotein metabolic process	IBA	21873635
GO:0042158	Process	Lipoprotein biosynthetic process	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042627	Component	Chylomicron	IBA	21873635
GO:0042632	Process	Cholesterol homeostasis	IBA	21873635
GO:0042632	Process	Cholesterol homeostasis	IDA	21571275
GO:0042632	Process	Cholesterol homeostasis	IMP	15464323
GO:0042802	Function	Identical protein binding	IPI	8049247, 17676061, 18719128, 20133843, 20884842, 22184756, 22609356, 24316228, 24702826
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0043687	Process	Post-translational protein modification	TAS
GO:0043691	Process	Reverse cholesterol transport	IBA	21873635
GO:0043691	Process	Reverse cholesterol transport	IMP	15464323
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045499	Function	Chemorepellent activity	IDA	23726972
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IBA	21873635
GO:0046470	Process	Phosphatidylcholine metabolic process	IBA	21873635
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IBA	21873635
GO:0050728	Process	Negative regulation of inflammatory response	IDA	21571275
GO:0050766	Process	Positive regulation of phagocytosis	IDA	20495215
GO:0050821	Process	Protein stabilization	IDA	17655203, 20495215
GO:0050919	Process	Negative chemotaxis	IDA	23726972
GO:0051006	Process	Positive regulation of lipoprotein lipase activity	IBA	21873635
GO:0051180	Process	Vitamin transport	IMP	15140193
GO:0051345	Process	Positive regulation of hydrolase activity	IDA	7638166
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	23726972
GO:0055085	Process	Transmembrane transport	TAS
GO:0055091	Process	Phospholipid homeostasis	IDA	21571275
GO:0055102	Function	Lipase inhibitor activity	IEA
GO:0060192	Process	Negative regulation of lipase activity	IEA
GO:0060228	Function	Phosphatidylcholine-sterol O-acyltransferase activator activity	IBA	21873635
GO:0060228	Function	Phosphatidylcholine-sterol O-acyltransferase activator activity	IDA	4335615
GO:0060354	Process	Negative regulation of cell adhesion molecule production	IDA	21571275
GO:0060761	Process	Negative regulation of response to cytokine stimulus	IDA	21571275
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070328	Process	Triglyceride homeostasis	IBA	21873635
GO:0070328	Process	Triglyceride homeostasis	IDA	21571275
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	23726972
GO:0070508	Process	Cholesterol import	IMP	14718538
GO:0070653	Function	High-density lipoprotein particle receptor binding	IBA	21873635
GO:0070653	Function	High-density lipoprotein particle receptor binding	IPI	10764676, 12651854
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0120009	Process	Intermembrane lipid transfer	IEA
GO:0120020	Function	Cholesterol transfer activity	IDA	9651324
GO:0120020	Function	Cholesterol transfer activity	IMP	15464323
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	23726972
GO:1902995	Process	Positive regulation of phospholipid efflux	IDA	27472885
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
107680	600	ENSG00000118137

Protein

UniProt ID

P02647

Protein name

Apolipoprotein A-I (Apo-AI) (ApoA-I) (Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I (ProapoA-I); Truncated apolipoprotein A-I (Apolipoprotein A-I(1-242))]

Protein function

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP comple

PDB

1AV1 , 1GW3 , 1GW4 , 1ODP , 1ODQ , 1ODR , 2MSC , 2MSD , 2MSE , 2N5E , 3K2S , 3R2P , 4V6M , 6CC9 , 6CCH , 6CCX , 6CLZ , 6CM1 , 6PTS , 6PTW , 6W4E , 6W4F , 7KJR , 7RSC , 7RSE , 8EQS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01442	Apolipoprotein	69 → 259	Apolipoprotein A1/A4/E domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in car

Sequence

MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ

Sequence length

267

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Amyloidosis	familial visceral amyloidosis	GenCC
Hypoalphalipoproteinemia	hypoalphalipoproteinemia, primary, 2	GenCC
Metabolic Syndrome	Metabolic Syndrome	GWAS
Dermatitis	Dermatitis	GWAS

Show/Hide Text Mining Associations (308)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	10854214, 15337168, 19324996, 21820994, 23233678, 30004693, 30665372, 31341020, 40429650, 7639323, 8675681, 9916936
Abetalipoproteinemia	Inhibit	7852858
Abnormalities Drug Induced	Associate	6421816
Achalasia Addisonianism Alacrimia syndrome	Associate	16403951
Acne Vulgaris	Inhibit	12485434
Acute Coronary Syndrome	Associate	22675253
Acute Lung Injury	Associate	24209603, 24885977
Adenocarcinoma of Lung	Associate	39745726
Alveolitis Extrinsic Allergic	Inhibit	33016012
Alzheimer Disease	Associate	19863188, 23181436, 28943632, 37307028
Alzheimer Disease	Inhibit	26491253
Amyloidosis	Associate	10854214, 1502149, 19324996, 23209431, 26562506, 28953655, 29455155, 30291643, 30665372, 32571483, 33573822, 35408859, 35502644, 37431665, 9461086, 9688527 View all (1 more)
Amyloidosis	Stimulate	32571494
Amyloidosis Familial	Associate	10487826, 11849445, 12050338, 1619367, 17600344, 21458433, 23233678, 25950566, 26562506, 27464946, 29455155, 30004693, 30665372, 31870425, 8675681, 9461086, 9916936 View all (2 more)
Amyloidosis familial visceral	Associate	10487826, 24925720, 26299174, 28953655, 35502644
Amyloidosis Primary Cutaneous	Associate	21820994
Amyotrophic Lateral Sclerosis	Inhibit	34518331
Amyotrophic Lateral Sclerosis	Associate	39278909
Anemia Sickle Cell	Associate	19023114, 20378559, 28436274
Angina Unstable	Associate	15489088
Aortic Aneurysm Abdominal	Associate	26774504, 30982767
Aortic Dissection	Associate	17109061
Arcus Senilis	Associate	1906882
Arthritis Gouty	Associate	15115711
Arthritis Psoriatic	Inhibit	22649206
Arthritis Psoriatic	Associate	34996506
Arthritis Rheumatoid	Stimulate	16778393
Arthritis Rheumatoid	Associate	18664547, 36639772
Ataxia	Associate	18458655
Atherosclerosis	Associate	10895970, 11557764, 11792730, 12576517, 17553166, 19181627, 19847320, 20385548, 21103356, 22219194, 22699570, 23233678, 24464187, 25170076, 26562506 View all (17 more)
Atherosclerosis	Inhibit	19471321, 29396407, 31842627
Atypical Squamous Cells of the Cervix	Associate	35421932
Autism Spectrum Disorder	Associate	34504056
Autistic Disorder	Associate	34504056
beta Thalassemia	Associate	34559910
Bipolar Disorder	Associate	26375446
Bone Diseases Metabolic	Associate	22619369
Bone Marrow Diseases	Stimulate	32383346
Brain Ischemia	Associate	22532455
Brain Neoplasms	Stimulate	24762496
Breast Diseases	Associate	35627123
Breast Neoplasms	Inhibit	19400944
Breast Neoplasms	Associate	21206008, 23829168, 34904415, 35627123, 40571309
Breast Neoplasms Male	Associate	30850364
Calcinosis Cutis	Associate	27662660
Carcinoma Hepatocellular	Inhibit	17828420, 24008390
Carcinoma Hepatocellular	Stimulate	22726459, 29998871
Carcinoma Hepatocellular	Associate	23935864, 24283668, 3007489, 6311811, 9507986
Carcinoma Non Small Cell Lung	Associate	35274478
Carcinoma Ovarian Epithelial	Associate	21708402
Carcinoma Pancreatic Ductal	Associate	33923185
Carcinoma Renal Cell	Associate	29689304, 35858961
Carcinoma Squamous Cell	Associate	25427637, 31912682
Cardiomyopathies	Associate	29447225
Cardiovascular Diseases	Associate	22219194, 24091356, 24273187, 24464187, 25170076, 26824674, 26842615, 28219664, 29776362, 30249788, 30298424, 31106471, 32174066, 8943493
Cardiovascular Diseases	Inhibit	26868508, 27418968
Carotid Stenosis	Associate	33086507, 39837394
Cerebral Arterial Diseases	Associate	26824674
Cerebral Infarction	Associate	27554116, 28635360, 32644829, 32891149
Cerebral Infarction	Inhibit	32981134, 39889961
Cerebral Small Vessel Diseases	Associate	32981134
Chemical and Drug Induced Liver Injury	Associate	32226013
Cholelithiasis	Associate	17853951
Cholesterol pneumonia	Associate	19681657, 7693760
Chronic Disease	Inhibit	33016012
Chylomicron retention disease	Associate	22104167
Clinical Deterioration	Associate	34504056
Cognition Disorders	Inhibit	22701550
Cognition Disorders	Associate	30241302, 34135129
Cognitive Dysfunction	Associate	36472389
Colonic Neoplasms	Associate	7615825
Colorectal Neoplasms	Associate	21199170, 26463353, 27662660, 30542696, 31300050, 34564974, 39889939
Colorectal Neoplasms	Inhibit	30098223
Corneal Endothelial Cell Loss	Inhibit	34944413
Corneal Opacity	Associate	1898657
Coronary Artery Disease	Associate	10803441, 10858436, 10895970, 11349008, 12576517, 12754559, 12964943, 15464323, 16403951, 1678604, 18801202, 19014618, 20307520, 21838883, 22297598 View all (18 more)
Coronary Artery Disease	Inhibit	1415250, 8755647
Coronary Artery Disease	Stimulate	3095836
Coronary Artery Disease Development of in HIV	Associate	34472376
Coronary Disease	Associate	11230170, 17654446, 19282639, 21804106, 24635344, 27554116, 28320750, 29439709, 29649363, 32203549, 32437778, 35527125, 6406984, 8282791
COVID 19	Associate	33504824, 34232570, 34324704, 37228606
COVID 19	Inhibit	33667465
Coxa Magna	Associate	26617857, 28770971
Cranial Nerve Injuries	Inhibit	38143756
Crohn Disease	Associate	25003194
Cryoglobulinemia	Stimulate	35677050
Cushing's symphalangism	Associate	16403951
Cystic Fibrosis	Associate	33050003
Death	Associate	34535154
Depressive Disorder	Associate	26491253
Diabetes Gestational	Associate	34665686
Diabetes Mellitus	Associate	10412780, 14510906, 17654446, 22675253, 28238629, 31504048, 34472376, 3936351, 40016689
Diabetes Mellitus	Inhibit	34159370, 37686357
Diabetes Mellitus Type 1	Associate	20622162
Diabetes Mellitus Type 2	Associate	14510906, 17654446, 29025405, 33667465, 3936351
Diabetes Mellitus Type 2	Inhibit	26337083
Down Syndrome	Inhibit	19108832
Drug Related Side Effects and Adverse Reactions	Associate	25950566
Dyskeratosis Congenita	Associate	34929494
Dyslipidemias	Associate	10803441, 21889769, 23829168, 25117371, 27173266, 28610615, 29758034
Dyslipidemias	Inhibit	33717107
Endodermal Sinus Tumor	Stimulate	21793190
Endometrial Neoplasms	Associate	19756734
Fatigue	Associate	23916682
Fibrosis	Associate	17625010, 36652164
Fragile X Syndrome	Inhibit	28334053
Friedreich Ataxia	Associate	29447225
Gallbladder Diseases	Associate	7616125
Gallbladder Neoplasms	Associate	27167107
Gallstones	Associate	7616125
Gangliosidosis GM1	Associate	15890646
Genetic Diseases Inborn	Associate	7693760
Glioblastoma	Associate	40617935
Glioma	Associate	24762496, 40617935
Glomerulonephritis IGA	Associate	28406696
Glomerulonephritis Membranous	Associate	28953655, 37511514
Glomerulosclerosis Focal Segmental	Associate	23205849, 31980684
Gout	Associate	15115711, 27094595
Graves Ophthalmopathy	Associate	35846879
Guillain Barre Syndrome	Inhibit	38143756
Hairy palms and soles	Stimulate	3118360
Heart Diseases	Associate	11266606, 29051568, 9916936
Heart Failure	Associate	28178939, 29447225, 9916936
Hemolytic Uremic Syndrome	Inhibit	10412780, 23219399, 8943493
Hemolytic Uremic Syndrome	Associate	19471321
Hemorrhage	Associate	22532455
Hemorrhagic Fever with Renal Syndrome	Associate	20797315
Hemostatic Disorders	Associate	17967773
Hepatitis B	Inhibit	27015844
Hepatitis B Chronic	Associate	25115832, 27015844
Hepatitis C	Associate	24008390
Hepatoblastoma	Inhibit	26053398
Hernia	Associate	23631828
HIV Infections	Associate	23067370
Homozygous Familial Hypercholesterolemia	Associate	37501168
Hypercholesterolemia	Associate	22243772
Hypercholesterolemia	Stimulate	3114402
Hyperglycemia	Associate	20622162
Hyperhomocysteinemia	Inhibit	26758372, 27457726
Hyperlipidemia Familial Combined	Associate	10064730, 10357835, 11181747, 14551155, 2883893, 8100834, 9062353
Hyperlipidemias	Associate	10357835, 21609439, 22916254, 27323196, 2883893, 31862910
Hyperlipoproteinemia Type I	Inhibit	27573733
Hyperlipoproteinemia Type II	Associate	10428988, 16721833, 22243772, 22675253, 27112635, 9026529
Hypersensitivity Immediate	Inhibit	1797940
Hypertension	Associate	15982502, 18801202, 25489783, 3082191, 33667465, 37154151
Hyperthyroidism	Associate	32575434
Hyperthyroidism	Stimulate	7628462
Hypertriglyceridemia	Associate	10895970, 11306522, 17919884, 23216302, 24919401, 3114402, 8445335
Hypertriglyceridemic Waist	Inhibit	20643837
Hypoalphalipoproteinemias	Associate	11306522, 11792730, 1619367, 1898657, 1981893, 20884842, 21458433, 22297598, 23066790, 28969676, 30333156, 8473493, 9654259
Hypoalphalipoproteinemias	Inhibit	25565309
Hypobetalipoproteinemia Familial 2	Associate	22659251
Hypobetalipoproteinemia Familial Apolipoprotein B	Associate	1901417
Hypogonadism	Associate	17507040
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	24925720
Hypothyroidism	Associate	27457726, 29301248
Hypotrichosis	Stimulate	15949702
Hypoxia	Associate	38190128
Idiopathic Noncirrhotic Portal Hypertension	Associate	34052252
Idiopathic Pulmonary Fibrosis	Inhibit	33016012
Idiopathic Pulmonary Fibrosis	Associate	36674438
Immunoglobulin Light chain Amyloidosis	Associate	21820994
Immunologic Deficiency Syndromes	Stimulate	3118360
Infarction Anterior Cerebral Artery	Inhibit	32981134
Infections	Associate	37966014
Infertility	Associate	17507040
Infertility	Stimulate	25405865
Inflammation	Associate	11219394, 16649161, 23965158, 24209603, 24885977, 25329888, 29618705, 32174066, 34944413, 37966014, 40010491
Inflammation	Inhibit	18621920, 21339300, 22786446, 22982462, 26681753, 32708494, 33430253, 34762399
Inflammation	Stimulate	25849372
Insulin Resistance	Associate	15115711, 20622162, 26553260, 30556889
Intrahepatic Cholestasis of Pregnancy	Associate	34559910
Kidney Diseases	Associate	31480040, 32174066
Kidney Failure Chronic	Associate	17600344
Kidney Neoplasms	Associate	26537097
Labor Pain	Associate	26824674
Laryngeal Diseases	Associate	10854214
Laryngitis	Associate	37431665
Lecithin Cholesterol Acyltransferase Deficiency	Associate	1898657, 29748187, 8445335, 9741700
Lecithin Cholesterol Acyltransferase Deficiency	Stimulate	3114402
Leukemia	Associate	23849470
Lipid Metabolism Disorders	Associate	25248404, 26617857
Liver Cirrhosis	Stimulate	15949702
Liver Cirrhosis Alcoholic	Associate	34033144
Liver Diseases	Associate	15949702, 17600344, 23935864
Liver Diseases Alcoholic	Associate	15949702
Liver Failure	Associate	33573822, 36652164
Lung Neoplasms	Associate	25105437, 36674438
Lupus Erythematosus Systemic	Associate	33640328
Lymphohistiocytosis Hemophagocytic	Associate	37653176
Macular Degeneration	Associate	28698208, 30404605
Macular Degeneration	Stimulate	33595494
Meningioma	Associate	25413266
Metabolic Syndrome	Associate	21410987, 22297598, 23215737, 26687706, 26824674, 29574070
Mitral Valve Insufficiency	Associate	27250500
Mouth Neoplasms	Associate	30987719
Mucositis	Associate	25003194
Multiple Myeloma	Associate	11266606, 12050338, 1502149, 15146166, 15337168, 21458433, 23066790, 24603325, 25881608, 31341020
Multiple Pulmonary Nodules	Inhibit	31335245
Multiple Sclerosis	Inhibit	33086557
Myelodysplastic Syndromes	Associate	35100989
Myocardial Infarction	Associate	15489088, 23209431, 23697869, 25170076, 30298424, 39295604
Myopia	Associate	38190128
Myopia Degenerative	Associate	38190128
Neointima	Associate	25565309
Neoplasm Metastasis	Associate	26537097
Neoplasm Metastasis	Inhibit	30098223
Neoplasm Metastasis	Stimulate	34564974
Neoplasms	Inhibit	19400944, 25265318, 34904415
Neoplasms	Associate	22294182, 23829168, 25986937, 26537097, 29430178, 30987719, 34520129, 34564974, 39889939, 40617935
Neoplasms Adipose Tissue	Associate	25137265
Neoplasms Squamous Cell	Associate	35421932
Neoplastic Syndromes Hereditary	Associate	33573822, 9916936
Nephrotic Syndrome	Associate	28953655
Nephrotic Syndrome	Stimulate	37511514
Neuralgia Postherpetic	Associate	37966014
Neuroblastoma	Associate	21833997
Niemann Pick Disease Type C	Associate	17020879
Non alcoholic Fatty Liver Disease	Associate	31503515
Non ST Elevated Myocardial Infarction	Inhibit	33667626
Obesity	Associate	12055319, 14510906, 20970753, 22016100, 25137265, 27173266, 28274171, 28969676, 29758034, 34472376
Obesity	Inhibit	28771179
Obesity Abdominal	Associate	28969676
Obesity Morbid	Associate	30556889
Oculocerebrorenal Syndrome	Associate	9654259
Oliguria	Inhibit	20797315
Osteoarthritis	Associate	22619369, 25849372
Osteonecrosis	Associate	25248404
Osteopenic Nonfracture Syndrome	Associate	22619369
Osteoporosis	Stimulate	37874452
Ovarian Neoplasms	Associate	31315664
Overweight	Associate	26687706
Pain	Associate	20378559
Pancreatic Neoplasms	Inhibit	24349355
Pancreatic Neoplasms	Associate	26337083
Pancreatitis	Associate	36360205
Parkinson Disease	Inhibit	25227208, 37479568
Parkinson Disease	Associate	25227208, 28943632
Pelvic Organ Prolapse	Inhibit	26612295
Peripheral Arterial Disease	Associate	39304430
Peripheral Nervous System Diseases	Associate	17600344
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	19324996
Plaque Amyloid	Associate	28953655, 31870425, 9461086
Plaque Atherosclerotic	Associate	11306522, 24464187, 25170076, 35304099
Pneumonia Lipid	Associate	24925720, 25005712
Polycystic Ovary Syndrome	Inhibit	10593369
Polycystic Ovary Syndrome	Associate	29636060
Polycystic Ovary Syndrome	Stimulate	32482257
Polycythemia Vera	Associate	18838204
Portal Vein Cavernous Transformation Of	Associate	17828420
Post Acute COVID 19 Syndrome	Associate	37228606
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	23849470
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	29180721
Prediabetic State	Associate	31504048
Pregnancy Complications	Associate	25117371
Prostatic Neoplasms	Stimulate	33586698
Psoriasis	Inhibit	23965158
Psychotic Disorders	Associate	25970596
Pulmonary Arterial Hypertension	Associate	19023114
Pulmonary Disease Chronic Obstructive	Associate	26306861, 39456887
Pulmonary Fibrosis	Associate	33016012
Purpura Thrombocytopenic Idiopathic	Associate	37942029
Pyloric Stenosis Hypertrophic	Associate	23989729
Rectal Neoplasms	Associate	35945555
Renal Insufficiency Chronic	Associate	31480040, 32046176, 40010491
Reperfusion Injury	Associate	37009888
Retinal Detachment	Associate	29618920
Retinal Diseases	Associate	32571483
Retinal Drusen	Associate	30404605
Retroperitoneal liposarcoma	Associate	36438917
Rhegmatogenous Retinal Detachment Autosomal Dominant	Stimulate	29618920
Rhinitis Allergic	Inhibit	31185305
Schizophrenia	Associate	24710015, 34135129
Scleral Diseases	Associate	38190128
Seizures	Associate	16403951
Sepsis	Associate	24885977, 35681439
Severe Acute Respiratory Syndrome	Inhibit	16649161
Skin Diseases	Associate	10854214
Sleep Initiation and Maintenance Disorders	Associate	35432581
Sleep Initiation and Maintenance Disorders	Inhibit	38087303
Small Cell Lung Carcinoma	Associate	26996551, 28448532
Smoke Inhalation Injury	Associate	26824674
Squamous Cell Carcinoma of Head and Neck	Associate	37686462
ST Elevation Myocardial Infarction	Inhibit	30298424
ST Elevation Myocardial Infarction	Associate	33957898, 36574567
Stomach Neoplasms	Associate	12923326, 24404153, 32176636, 35627105, 36430456, 37846989
Stroke	Associate	28238629
Subarachnoid Hemorrhage	Associate	29769126
Tangier Disease	Inhibit	10884295, 25227739
Tangier Disease	Associate	11181755, 11309399, 11349008, 12624133, 12869555, 14747463, 15066991, 16443932, 1898657, 19202195, 2504859, 26687706, 2995392, 3105587, 6198645 View all (5 more)
Testicular Diseases	Associate	17507040
Thrombosis	Associate	28540474, 40429650
Trigeminal Neuralgia	Associate	32553624
Trisomy 18 Syndrome	Inhibit	19108832
Trisomy 18 Syndrome	Associate	26752631
Uremia	Inhibit	23219399
Urinary Bladder Neoplasms	Associate	23631828
Uterine Cervical Neoplasms	Associate	22027750, 25427637, 30625128, 31912682, 35421932
Uterine Cervicitis	Associate	25427637
Uveal melanoma	Associate	33120861
Vascular Diseases	Associate	15464323
Venous Thrombosis	Associate	28540474
Ventricular Fibrillation	Associate	10854214
Vitreoretinopathy Proliferative	Stimulate	29618920
Weight Gain	Associate	34267728
Weight Loss	Associate	25137265
Xanthomatosis	Associate	1797940, 7693760
Xanthomatosis Cerebrotendinous	Associate	7298854

APOA1 (apolipoprotein A1)