Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	207
Gene name	AKT serine/threonine kinase 1
Gene symbol	AKT1
Synonyms (NCBI Gene)	AKTPKBPKB-ALPHAPRKBARACRAC-ALPHA
Chromosome	14
Chromosome location	14q32.33
Summary	This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain,

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434592	C>T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs368667384	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, non coding transcript variant
rs397514644	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs397514645	T>G	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057518602	T>C	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1057519804	G>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1595251483	TC>CT	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

453

Show/Hide all (453)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003984	hsa-miR-199a-3p	Western blot	18456660
MIRT004363	hsa-miR-125b-5p	qRT-PCRWestern blot	18649363
MIRT004701	hsa-miR-185-5p	FlowImmunoblotMicroarrayqRT-PCR	19688090
MIRT005355	hsa-miR-149-3p	Luciferase reporter assayqRT-PCRWestern blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assayqRT-PCRWestern blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assayqRT-PCRWestern blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assayqRT-PCRWestern blot	20623644
MIRT005740	hsa-miR-451a	qRT-PCRWestern blot	20816946
MIRT007171	hsa-miR-302a-3p	Luciferase reporter assay	23185040
MIRT007171	hsa-miR-302a-3p	Luciferase reporter assay	23185040
MIRT007172	hsa-miR-302b-3p	Luciferase reporter assay	23185040
MIRT007172	hsa-miR-302b-3p	Luciferase reporter assay	23185040
MIRT007173	hsa-miR-302c-3p	Luciferase reporter assay	23185040
MIRT007173	hsa-miR-302c-3p	Luciferase reporter assay	23185040
MIRT007174	hsa-miR-302d-3p	Luciferase reporter assay	23185040
MIRT007174	hsa-miR-302d-3p	Luciferase reporter assay	23185040
MIRT007179	hsa-miR-143-3p	Luciferase reporter assayqRT-PCRWestern blot	23104321
MIRT005355	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR;Other	20623644
MIRT029530	hsa-miR-26b-5p	Microarray	19088304
MIRT041236	hsa-miR-193b-3p	CLASH	23622248
MIRT053334	hsa-miR-100-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23724047
MIRT054156	hsa-miR-19a-3p	qRT-PCRWestern blot	25400827
MIRT054875	hsa-miR-133b	Luciferase reporter assayqRT-PCRWestern blot	25414595
MIRT437386	hsa-miR-708-5p	FlowqRT-PCRWestern blot	23754151
MIRT437912	hsa-miR-105-5p	Luciferase reporter assayWestern blot	25280563
MIRT054156	hsa-miR-19a-3p	qRT-PCRWestern blot	25914465
MIRT438059	hsa-miR-27a-5p	In situ hybridizationqRT-PCR	23963114
MIRT054156	hsa-miR-19a-3p	qRT-PCRWestern blot	25914465
MIRT438059	hsa-miR-27a-5p	In situ hybridizationqRT-PCR	23963114
MIRT543156	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT543155	hsa-miR-188-5p	PAR-CLIP	21572407
MIRT543154	hsa-miR-6866-3p	PAR-CLIP	21572407
MIRT543153	hsa-miR-7110-3p	PAR-CLIP	21572407
MIRT543151	hsa-miR-6817-3p	PAR-CLIP	21572407
MIRT543152	hsa-miR-518c-5p	PAR-CLIP	21572407
MIRT543150	hsa-miR-326	PAR-CLIP	21572407
MIRT543149	hsa-miR-330-5p	PAR-CLIP	21572407
MIRT543148	hsa-miR-6764-3p	PAR-CLIP	21572407
MIRT543147	hsa-miR-6824-3p	PAR-CLIP	21572407
MIRT543146	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT543145	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT543144	hsa-miR-378b	PAR-CLIP	21572407
MIRT543143	hsa-miR-378c	PAR-CLIP	21572407
MIRT543142	hsa-miR-378d	PAR-CLIP	21572407
MIRT543141	hsa-miR-378e	PAR-CLIP	21572407
MIRT543140	hsa-miR-378f	PAR-CLIP	21572407
MIRT543139	hsa-miR-378h	PAR-CLIP	21572407
MIRT543138	hsa-miR-378i	PAR-CLIP	21572407
MIRT543137	hsa-miR-422a	PAR-CLIP	21572407
MIRT543136	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT543135	hsa-miR-6873-3p	PAR-CLIP	21572407
MIRT543134	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT442870	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442869	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442868	hsa-miR-4757-3p	PAR-CLIP	22100165
MIRT442867	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442866	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442865	hsa-miR-496	PAR-CLIP	22100165
MIRT442864	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT442863	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	25187230
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	25187230
MIRT731198	hsa-miR-637	ImmunohistochemistryIn situ hybridizationWestern blotLuciferase reporter assay	25597410
MIRT731198	hsa-miR-637	ImmunohistochemistryIn situ hybridizationWestern blotLuciferase reporter assay	25597410
MIRT731805	hsa-miR-495-3p	Luciferase reporter assayqRT-PCRWestern blot	27323412
MIRT731805	hsa-miR-495-3p	Luciferase reporter assayqRT-PCRWestern blot	27323412
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT277753	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT277753	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT277753	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT277753	hsa-miR-542-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	26286747
MIRT000425	hsa-miR-184	Luciferase reporter assay	27666871
MIRT736014	hsa-miR-126-3p	qRT-PCRWestern blot	26659078
MIRT732949	hsa-miR-4443	Microarray	33511213
MIRT735075	hsa-miR-6089	Luciferase reporter assayWestern blottingqRT-PCR	33028811
MIRT736013	hsa-miR-23b-3p	ImmunofluorescenceqRT-PCRFlow cytometry	32865424
MIRT736014	hsa-miR-126-3p	qRT-PCR	32865424
MIRT736501	hsa-miR-148a-3p	qRT-PCR	32624692
MIRT737431	hsa-miR-429	Luciferase reporter assayWestern blottingqRT-PCR	31814979
MIRT543156	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT543155	hsa-miR-188-5p	PAR-CLIP	21572407
MIRT543154	hsa-miR-6866-3p	PAR-CLIP	21572407
MIRT543153	hsa-miR-7110-3p	PAR-CLIP	21572407
MIRT543151	hsa-miR-6817-3p	PAR-CLIP	21572407
MIRT543152	hsa-miR-518c-5p	PAR-CLIP	21572407
MIRT543150	hsa-miR-326	PAR-CLIP	21572407
MIRT543149	hsa-miR-330-5p	PAR-CLIP	21572407
MIRT543148	hsa-miR-6764-3p	PAR-CLIP	21572407
MIRT543147	hsa-miR-6824-3p	PAR-CLIP	21572407
MIRT543146	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT543145	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT543144	hsa-miR-378b	PAR-CLIP	21572407
MIRT543143	hsa-miR-378c	PAR-CLIP	21572407
MIRT543142	hsa-miR-378d	PAR-CLIP	21572407
MIRT543141	hsa-miR-378e	PAR-CLIP	21572407
MIRT543140	hsa-miR-378f	PAR-CLIP	21572407
MIRT543139	hsa-miR-378h	PAR-CLIP	21572407
MIRT543138	hsa-miR-378i	PAR-CLIP	21572407
MIRT543137	hsa-miR-422a	PAR-CLIP	21572407
MIRT543136	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT543135	hsa-miR-6873-3p	PAR-CLIP	21572407
MIRT543134	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT442870	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442869	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442868	hsa-miR-4757-3p	PAR-CLIP	22100165
MIRT442867	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442866	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442865	hsa-miR-496	PAR-CLIP	22100165
MIRT442864	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT442863	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT755928	hsa-miR-142-3p	Luciferase reporter assayWestern blottingqRT-PCRin vitro cullelar assays	35194440
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT776408	hsa-miR-3974	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776417	hsa-miR-183	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT776420	hsa-miR-2681	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776434	hsa-miR-564	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776438	hsa-miR-1243	CLIP-seq
MIRT776439	hsa-miR-1255a	CLIP-seq
MIRT776440	hsa-miR-1255b	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT776442	hsa-miR-3154	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776444	hsa-miR-3179	CLIP-seq
MIRT776445	hsa-miR-3185	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT776447	hsa-miR-3616-3p	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT776449	hsa-miR-374a	CLIP-seq
MIRT776450	hsa-miR-374b	CLIP-seq
MIRT776451	hsa-miR-3919	CLIP-seq
MIRT776408	hsa-miR-3974	CLIP-seq
MIRT776452	hsa-miR-4273	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776454	hsa-miR-4303	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT776456	hsa-miR-4445	CLIP-seq
MIRT776457	hsa-miR-4446-3p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776459	hsa-miR-4462	CLIP-seq
MIRT776460	hsa-miR-4504	CLIP-seq
MIRT776461	hsa-miR-4511	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776463	hsa-miR-4656	CLIP-seq
MIRT776464	hsa-miR-4677-5p	CLIP-seq
MIRT776465	hsa-miR-4709-3p	CLIP-seq
MIRT776466	hsa-miR-4717-5p	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT776468	hsa-miR-4747-5p	CLIP-seq
MIRT776469	hsa-miR-4756-3p	CLIP-seq
MIRT776470	hsa-miR-495	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776471	hsa-miR-548aa	CLIP-seq
MIRT776472	hsa-miR-548c-3p	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT776475	hsa-miR-633	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT776477	hsa-miR-891b	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq
MIRT1929178	hsa-miR-105	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT1929179	hsa-miR-1273	CLIP-seq
MIRT1929180	hsa-miR-1285	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT1929181	hsa-miR-136	CLIP-seq
MIRT1929182	hsa-miR-1470	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT1929183	hsa-miR-2277-3p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT1929185	hsa-miR-3074-5p	CLIP-seq
MIRT1929186	hsa-miR-3124-3p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776442	hsa-miR-3154	CLIP-seq
MIRT1929188	hsa-miR-3158-3p	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776444	hsa-miR-3179	CLIP-seq
MIRT1929190	hsa-miR-3180	CLIP-seq
MIRT1929191	hsa-miR-3180-3p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT1929192	hsa-miR-3187-5p	CLIP-seq
MIRT1929193	hsa-miR-3196	CLIP-seq
MIRT1929194	hsa-miR-3202	CLIP-seq
MIRT1929195	hsa-miR-3610	CLIP-seq
MIRT1929196	hsa-miR-3613-5p	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT1929198	hsa-miR-371-5p	CLIP-seq
MIRT1929199	hsa-miR-371b-5p	CLIP-seq
MIRT776449	hsa-miR-374a	CLIP-seq
MIRT776450	hsa-miR-374b	CLIP-seq
MIRT1929200	hsa-miR-378g	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT1929201	hsa-miR-4271	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT1929202	hsa-miR-4421	CLIP-seq
MIRT1929203	hsa-miR-4437	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT1929205	hsa-miR-4486	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT1929206	hsa-miR-455-3p	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT1929207	hsa-miR-4667-3p	CLIP-seq
MIRT1929208	hsa-miR-4674	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT1929211	hsa-miR-4716-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT1929213	hsa-miR-4723-5p	CLIP-seq
MIRT1929214	hsa-miR-4725-3p	CLIP-seq
MIRT1929215	hsa-miR-4728-5p	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929217	hsa-miR-4738-5p	CLIP-seq
MIRT1929218	hsa-miR-4740-3p	CLIP-seq
MIRT776468	hsa-miR-4747-5p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT1929221	hsa-miR-4768-5p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT1929222	hsa-miR-501-3p	CLIP-seq
MIRT1929223	hsa-miR-502-3p	CLIP-seq
MIRT1929224	hsa-miR-539	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT1929226	hsa-miR-561	CLIP-seq
MIRT776434	hsa-miR-564	CLIP-seq
MIRT1929227	hsa-miR-586	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT1929228	hsa-miR-612	CLIP-seq
MIRT776475	hsa-miR-633	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT1929229	hsa-miR-661	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT1929231	hsa-miR-942	CLIP-seq
MIRT1929178	hsa-miR-105	CLIP-seq
MIRT1929180	hsa-miR-1285	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT1929182	hsa-miR-1470	CLIP-seq
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT1929183	hsa-miR-2277-3p	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT1929186	hsa-miR-3124-3p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT1929192	hsa-miR-3187-5p	CLIP-seq
MIRT2169824	hsa-miR-3200-5p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT1929198	hsa-miR-371-5p	CLIP-seq
MIRT1929199	hsa-miR-371b-5p	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT1929200	hsa-miR-378g	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT2169825	hsa-miR-4281	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT1929203	hsa-miR-4437	CLIP-seq
MIRT1929205	hsa-miR-4486	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT1929207	hsa-miR-4667-3p	CLIP-seq
MIRT1929208	hsa-miR-4674	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT2169826	hsa-miR-4726-3p	CLIP-seq
MIRT1929217	hsa-miR-4738-5p	CLIP-seq
MIRT1929221	hsa-miR-4768-5p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT1929228	hsa-miR-612	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT1929231	hsa-miR-942	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT2472682	hsa-miR-296-5p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT2472683	hsa-miR-3200-3p	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT2472684	hsa-miR-3545-3p	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT2472685	hsa-miR-374c	CLIP-seq
MIRT2472686	hsa-miR-3918	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT2472687	hsa-miR-4268	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT2472688	hsa-miR-4448	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT2472689	hsa-miR-4698	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT2472690	hsa-miR-4731-3p	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT2472691	hsa-miR-4801	CLIP-seq
MIRT2472692	hsa-miR-4803	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776470	hsa-miR-495	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT2472693	hsa-miR-548ac	CLIP-seq
MIRT2472694	hsa-miR-548ae	CLIP-seq
MIRT2472695	hsa-miR-548aj	CLIP-seq
MIRT2472696	hsa-miR-548am	CLIP-seq
MIRT2472697	hsa-miR-548d-3p	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT2472698	hsa-miR-548x	CLIP-seq
MIRT2472699	hsa-miR-548z	CLIP-seq
MIRT1929227	hsa-miR-586	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT2472700	hsa-miR-655	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT2472682	hsa-miR-296-5p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT2472684	hsa-miR-3545-3p	CLIP-seq
MIRT1929195	hsa-miR-3610	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT2472686	hsa-miR-3918	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
APC	Repression	15888491
AR	Activation	11278645
AR	Repression	20589722
GLI1	Unknown	23580656
NFKB1	Repression	18031796
RELA	Repression	18031796
STAT3	Unknown	16007214
TP53	Repression	12485897

293

Show/Hide all (293)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001649	Process	Osteoblast differentiation	IDA	22869525
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001893	Process	Maternal placenta development	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19850054
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0002430	Process	Complement receptor mediated signaling pathway	IDA	19162005
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IMP	18558630
GO:0004672	Function	Protein kinase activity	IDA	31204173
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10570282
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	10376603, 17030608
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8524413, 10102273, 10983986, 11994271, 12172553, 14749367, 15861136, 16139227, 16540465, 17386266, 19667065, 23512198, 24529379, 26440888, 29343641, 30504268, 30514904, 31548394, 32322062, 33594058
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	19573808
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	21432781, 21711983
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	19162005, 22797923
GO:0005515	Function	Protein binding	IPI	10102273, 10983986, 11154276, 11438723, 11839802, 12176997, 12244133, 12791994, 16044149, 16139227, 16280327, 16282323, 16417524, 16525023, 16537421, 16792529, 17006541, 17577629, 17932490, 18191226, 18292230, 18505846, 18562279, 18624398, 18650932, 18786403, 19122674, 19162005, 191
GO:0005516	Function	Calmodulin binding	IDA	29104511
GO:0005524	Function	ATP binding	IC	11994271
GO:0005524	Function	ATP binding	IDA	16540465
GO:0005524	Function	ATP binding	IEA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	19203586
GO:0005634	Component	Nucleus	IDA	20333297
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	21432781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	26440888
GO:0005737	Component	Cytoplasm	IDA	19203586, 25190803
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	21432781
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005758	Component	Mitochondrial intermembrane space	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	21045808
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	14749367, 19203586, 20333297
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	21432781
GO:0005911	Component	Cell-cell junction	IEA
GO:0005929	Component	Cilium	IDA
GO:0005938	Component	Cell cortex	NAS	19126672
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IMP	8940145
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006094	Process	Gluconeogenesis	IDA	30193097
GO:0006413	Process	Translational initiation	IDA	16289705
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	14749367
GO:0006468	Process	Protein phosphorylation	IDA	11994271, 23431171
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	33594058
GO:0006606	Process	Protein import into nucleus	IMP	16280327
GO:0006607	Process	NLS-bearing protein import into nucleus	IDA	14645851
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	10376602
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	17684057
GO:0006893	Process	Golgi to plasma membrane transport	IDA	35343654
GO:0006915	Process	Apoptotic process	IEA
GO:0006924	Process	Activation-induced cell death of T cells	IMP	14749367
GO:0006954	Process	Inflammatory response	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0007165	Process	Signal transduction	TAS	10570282, 21432781
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	20878056
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	18483258
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10570282
GO:0007281	Process	Germ cell development	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008283	Process	Cell population proliferation	TAS	21432781
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IMP	8978681
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009267	Process	Cellular response to starvation	IDA	24529379
GO:0009408	Process	Response to heat	IEA
GO:0009408	Process	Response to heat	TAS	10958679
GO:0009725	Process	Response to hormone	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	18387192
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	18558630
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	28341552
GO:0010628	Process	Positive regulation of gene expression	ISS	18292230
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010748	Process	Negative regulation of long-chain fatty acid import across plasma membrane	IMP	16814735
GO:0010761	Process	Fibroblast migration	NAS	19126672
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010765	Process	Positive regulation of sodium ion transport	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IDA	24529379
GO:0016020	Component	Membrane	IEA
GO:0016242	Process	Negative regulation of macroautophagy	NAS	23778976
GO:0016301	Function	Kinase activity	IDA	14749367
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	IDA	20333297
GO:0016477	Process	Cell migration	IDA	23512198
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	16139227, 32322062
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	20605787
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019899	Function	Enzyme binding	ISS
GO:0019900	Function	Kinase binding	IPI	21177249
GO:0019901	Function	Protein kinase binding	IEA
GO:0022605	Process	Mammalian oogenesis stage	IEA
GO:0030027	Component	Lamellipodium	NAS	19126672
GO:0030154	Process	Cell differentiation	TAS	21432781
GO:0030163	Process	Protein catabolic process	IEA
GO:0030235	Function	Nitric-oxide synthase regulator activity	IMP	10376603
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	ISS
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	TAS	21711983
GO:0030307	Process	Positive regulation of cell growth	IDA	19203586
GO:0030334	Process	Regulation of cell migration	IMP	19934221
GO:0030334	Process	Regulation of cell migration	TAS	21432781
GO:0030335	Process	Positive regulation of cell migration	IDA	35609316
GO:0030335	Process	Positive regulation of cell migration	IDA	38020884
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	21177249
GO:0030336	Process	Negative regulation of cell migration	IDA	27494834
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	18485873, 29343641
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	39880951
GO:0031295	Process	T cell costimulation	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	18292230
GO:0031641	Process	Regulation of myelination	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	29236692, 29750193, 31601708, 36528027
GO:0031929	Process	TOR signaling	NAS	23778976
GO:0031982	Component	Vesicle	IDA	16792529
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032079	Process	Positive regulation of endodeoxyribonuclease activity	IDA	20605787
GO:0032094	Process	Response to food	IEA
GO:0032287	Process	Peripheral nervous system myelin maintenance	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	23512198
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	12172553, 17386266, 24529379
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032991	Component	Protein-containing complex	IDA	20878056, 23223530
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	19667065
GO:0033554	Process	Cellular response to stress	TAS
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IDA	35343654
GO:0034123	Process	Positive regulation of toll-like receptor signaling pathway	IDA	35343654
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	10196138
GO:0034198	Process	Cellular response to amino acid starvation	IDA	26972053, 33594058, 35338845
GO:0034405	Process	Response to fluid shear stress	IMP	10376603
GO:0035519	Process	Protein K29-linked ubiquitination	IDA	33594058
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	14749367
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	21321938
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0036294	Process	Cellular response to decreased oxygen levels	IEA
GO:0036316	Process	SREBP-SCAP complex retention in endoplasmic reticulum	IDA	12202038, 15899885, 32322062
GO:0036416	Process	TRNA stabilization	IDA	36599982, 36599985
GO:0036444	Process	Calcium import into the mitochondrion	IDA	22925203, 32494073
GO:0036444	Process	Calcium import into the mitochondrion	IMP	23755363
GO:0036499	Process	PERK-mediated unfolded protein response	IDA	25925385, 31023583
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IPI	7891724, 17554339, 35512704
GO:0042803	Function	Protein homodimerization activity	IDA	10983986
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043001	Process	Golgi to plasma membrane protein transport	IMP	25673879
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19203586
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	23512198
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043276	Process	Anoikis	NAS	23778976
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	19203586
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19162005, 21321938, 28147277
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	9373175, 18483258, 28341552
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	21711983
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	20011604
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	10376603
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	12177166
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IMP	12177166
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	8940145
GO:0045724	Process	Positive regulation of cilium assembly	IDA	26258637
GO:0045724	Process	Positive regulation of cilium assembly	IMP	25673879, 31204173
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	NAS	17925406
GO:0045746	Process	Negative regulation of Notch signaling pathway	TAS
GO:0045861	Process	Negative regulation of proteolysis	IMP	18387192
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19057511
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046209	Process	Nitric oxide metabolic process	TAS
GO:0046326	Process	Positive regulation of D-glucose import	IMP	8940145, 16814735
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0046777	Process	Protein autophosphorylation	TAS	16280327
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IDA	32322062
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IMP	8940145
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IMP	8978681
GO:0048266	Process	Behavioral response to pain	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21321938
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	ISS
GO:0051604	Process	Protein maturation	EXP	11163209
GO:0051604	Process	Protein maturation	IDA	11163209
GO:0051604	Process	Protein maturation	IMP	21719679
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060416	Process	Response to growth hormone	ISS
GO:0060627	Process	Regulation of vesicle-mediated transport	IMP	31204173
GO:0060644	Process	Mammary gland epithelial cell differentiation	TAS	21432781
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061512	Process	Protein localization to cilium	IMP	25673879
GO:0070141	Process	Response to UV-A	IDA	18483258
GO:0070848	Process	Response to growth factor	IDA	33505021
GO:0070972	Process	Protein localization to endoplasmic reticulum	IDA	35343654
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	35343654
GO:0071277	Process	Cellular response to calcium ion	IDA	32494073
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	30514904
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071889	Function	14-3-3 protein binding	IPI	10102273
GO:0072350	Process	Tricarboxylic acid metabolic process	IDA	30193097
GO:0072655	Process	Establishment of protein localization to mitochondrion	IMP	23962723
GO:0072656	Process	Maintenance of protein location in mitochondrion	IMP	23962723
GO:0072752	Process	Cellular response to rapamycin	ISS
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	ISS
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097700	Process	Vascular endothelial cell response to laminar fluid shear stress	TAS
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099104	Function	Potassium channel activator activity	IDA	33505021
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:0106004	Process	TRNA (guanine-N7)-methylation	IDA	36599982, 36599985
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	TAS
GO:0110002	Process	Regulation of tRNA methylation	IDA	15861136
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:0140896	Process	CGAS/STING signaling pathway	IDA	30842659, 30842662, 32911482, 32912999
GO:0150033	Process	Negative regulation of protein localization to lysosome	IDA	24529379
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	12172553, 26440888
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18483258
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	20605787
GO:1901653	Process	Cellular response to peptide	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1902018	Process	Negative regulation of cilium assembly	IDA	31204173
GO:1902018	Process	Negative regulation of cilium assembly	IMP	31204173
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	NAS	16604263
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	8940145
GO:1903318	Process	Negative regulation of protein maturation	ISS
GO:1903384	Process	Negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway	IMP	21177249
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	ISS
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	9045618, 12906785, 17386266, 26972053, 33594058, 35338845
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692, 31601708, 33594058, 36528027
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	12172553, 17386266, 24529379, 30514904, 31548394, 33594058
GO:1904515	Process	Positive regulation of TORC2 signaling	IEA
GO:1904841	Function	TORC2 complex binding	IDA	21177249
GO:1905552	Process	Positive regulation of protein localization to endoplasmic reticulum	IDA	32322062
GO:1905786	Process	Positive regulation of anaphase-promoting complex-dependent catabolic process	IDA	29343641
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IMP	20605787
GO:1990418	Process	Response to insulin-like growth factor stimulus	ISS
GO:2000010	Process	Positive regulation of protein localization to cell surface	IEA
GO:2000074	Process	Regulation of type B pancreatic cell development	TAS
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	10748004
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
164730	391	ENSG00000142208

P31749

Protein name

RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)

Protein function

AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis (PubMed:11882383, PubMed

PDB

1H10 , 1UNP , 1UNQ , 1UNR , 2UVM , 2UZR , 2UZS , 3CQU , 3CQW , 3MV5 , 3MVH , 3O96 , 3OCB , 3OW4 , 3QKK , 3QKL , 3QKM , 4EJN , 4EKK , 4EKL , 4GV1 , 5KCV , 6BUU , 6CCY , 6HHF , 6HHG , 6HHH , 6HHI , 6HHJ , 6NPZ , 6S9W , 6S9X , 7APJ , 7MYX , 7NH4 , 7NH5 , 8JOW , 8UVY , 8UW2 , 8UW7 , 8UW9 , 8ZPU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	6 → 108	PH domain	Domain
PF00069	Pkinase	150 → 408	Protein kinase domain	Domain
PF00433	Pkinase_C	429 → 474	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in prostate cancer and levels increase from the normal to the malignant state (at protein level). Expressed in all human cell types so far analyzed. The Tyr-176 phosphorylated form shows a significant increase in expression i

Sequence

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

Sequence length

480

Interactions

View interactions

613

Show/Hide Causal Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Breast adenocarcinoma	Pathogenic	rs121434592	RCV000015017
Carcinoma of colon	Pathogenic	rs121434592	RCV000015018
Cowden syndrome 6	Pathogenic	rs121434592, rs397514644, rs397514645	RCV000795313 RCV000033177 RCV000033178
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Pathogenic	rs121434592	RCV006253621
Medulloblastoma SHH activated and TP53 wild-type	Pathogenic	rs121434592	RCV006253622
Meningioma	Pathogenic	rs121434592	RCV005647963
Neoplasm	Pathogenic	rs121434592	RCV004668732
Ovarian neoplasm	Pathogenic	rs121434592	RCV000015019
Proteus syndrome	Pathogenic	rs121434592, rs1595251483	RCV000031926 RCV000984546

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs17846832	RCV005916791
AKT1-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	rs146875699, rs1424916218, rs772346934, rs748603087, rs139297659, rs369048965, rs11555434, rs767715614, rs143933508, rs1060503071, rs151254374, rs368553273, rs755530413, rs184263655, rs374865919, rs200724383, rs529348439, rs760365810 View all (3 more)	RCV003965004 RCV003956430 RCV003933371 RCV003418492 RCV003927884 RCV003982951 RCV003977667 RCV003907874 RCV003970358 RCV003401486 RCV003935508 RCV003965445 RCV003908189 RCV003928401 RCV004745624 RCV003930372 RCV003895321 RCV003413852
Cervical cancer	Benign; Likely benign	rs17846832, rs11555434, rs1036107517	RCV005916792 RCV005895300 RCV005910968
Cholangiocarcinoma	Benign	rs17846832, rs3730346	RCV005916795 RCV005922158
Clear cell carcinoma of kidney	Benign; Likely benign	rs11555434	RCV005895301
Colorectal cancer	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	rs1168658858, rs1016707349, rs1160152822, rs1401652672, rs113547523, rs56289559, rs1060503071, rs983007851, rs758456890, rs377076374, rs749186394, rs760365810, rs766000895	RCV005006179 RCV005008380 RCV005011207 RCV005010869 RCV005008148 RCV002500786 RCV005010365 RCV005010521 RCV005010631 RCV005010716 RCV005012504 RCV005012492 RCV005012642
Familial cancer of breast	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	rs2140910178, rs1168658858, rs1016707349, rs2140903030, rs1160152822, rs1401652672, rs113547523, rs56289559, rs1060503071, rs983007851, rs758456890, rs377076374, rs749186394, rs760365810, rs1892625907, rs766000895 View all (1 more)	RCV001528119 RCV005006179 RCV005008380 RCV002248964 RCV005011207 RCV005010869 RCV005008148 RCV002500786 RCV005010365 RCV005010521 RCV005010631 RCV005010716 RCV005012504 RCV005012492 RCV001197033 RCV005012642
Gastric cancer	Likely benign	rs1489572550	RCV005909040
Hereditary cancer	Conflicting classifications of pathogenicity	rs146875699	RCV003492516
Lung adenocarcinoma	Uncertain significance	rs2542153939	RCV003129638
Lung cancer	Benign; Likely benign	rs11555434	RCV005895304
Malignant tumor of esophagus	Uncertain significance	rs377076374	RCV005901759
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs11555434	RCV005895299
Ovarian cancer	Uncertain significance; Conflicting classifications of pathogenicity	rs1168658858, rs1016707349, rs1160152822, rs1401652672, rs113547523, rs1060503071, rs983007851, rs758456890, rs377076374, rs749186394, rs760365810, rs766000895	RCV005006179 RCV005008380 RCV005011207 RCV005010869 RCV005008148 RCV005010365 RCV005010521 RCV005010631 RCV005010716 RCV005012504 RCV005012492 RCV005012642
Ovarian serous cystadenocarcinoma	Likely benign	rs777639707	RCV005927125
Schizophrenia	Benign; Likely benign	rs754944632	RCV003989753
See cases	Uncertain significance	rs982744857	RCV004584544
Squamous cell carcinoma	Uncertain significance; Benign	rs2542139370, rs528047226	RCV003129653 RCV003129721
Thymoma	Benign	rs3730346	RCV005922157
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	rs11555434	RCV005895303
Uterine carcinosarcoma	Benign; Likely benign	rs17846832, rs11555434, rs1130233	RCV005916794 RCV005895302 RCV005898668
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs17846832, rs11555434	RCV005916796 RCV005895305
Uveal melanoma	Benign	rs17846832, rs3730346, rs1130233	RCV005916793 RCV005922156 RCV005898667

Show/Hide Text Mining Associations (892)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	22363598
AA amyloidosis	Associate	36065437
Abortion Threatened	Associate	32775426
Achalasia Addisonianism Alacrimia syndrome	Associate	22431556
Acidosis	Stimulate	25504433, 35046108
Acidosis Lactic	Associate	32152504
Acquired ichthyosis	Associate	36303457
Acrocephalosyndactylia	Associate	17003487
Acute Disease	Associate	37295770
Acute Kidney Injury	Associate	34802380
Acute Lung Injury	Associate	36430900
Acute On Chronic Liver Failure	Associate	26173605
Adenocarcinoma	Associate	17150102, 17559672, 19090006, 19445727, 20858736, 26315110, 26317790, 26683690, 27013585, 27814385, 30535430, 31275989, 33865336, 34887308, 35322195, 36239337, 39739112 View all (2 more)
Adenocarcinoma	Stimulate	25337238
Adenocarcinoma Clear Cell	Associate	37697729
Adenocarcinoma Follicular	Associate	34171097, 36521425
Adenocarcinoma Mucinous	Associate	25714871, 31243107, 33947930, 35312980, 35794510, 37768171
Adenocarcinoma of Lung	Associate	14614329, 19047111, 19139118, 21122157, 23298487, 23443799, 25278243, 25342384, 25763322, 25978653, 26023239, 26314828, 26556867, 27383307, 27494877 View all (47 more)
Adenoma	Associate	22551172, 27079615, 31411736, 37028599
Adenoma	Stimulate	26048755
Adenoma Pleomorphic	Associate	32702887
Adenomatous Polyposis Coli	Associate	32099073
Adenomyoepithelioma	Associate	29739933
Adenomyosis	Associate	29762822, 30365102
Adenoviridae Infections	Associate	16160160
Adrenal Cortex Diseases	Associate	25722288
Aggressive Periodontitis	Inhibit	19892919
Aicardi Syndrome	Associate	31857685
Airway Remodeling	Associate	21828035
Alcohol Related Disorders	Associate	38136956
Allergic Fungal Sinusitis	Associate	35747690
Alopecia	Associate	29439547, 31991762
Altitude Sickness	Associate	29176544
Alzheimer Disease	Associate	12645527, 16014629, 18818877, 22044025, 23095849, 24077433, 24735980, 26178916, 28025562, 28922161, 30080220, 30611996, 32192109, 32980851, 33605427 View all (12 more)
Alzheimer Disease	Inhibit	32035419
Ameloblastoma	Associate	32719259
Amyotrophic Lateral Sclerosis	Associate	28158451, 31196199, 37682161
Androgen Insensitivity Syndrome	Associate	29365031, 35732329
Anemia Diamond Blackfan	Associate	29745857
Anemia Sickle Cell	Associate	25316332
Aneuploidy	Associate	26608463
Angina Stable	Associate	36435742
Angina Unstable	Associate	20467748
Anhedonia	Associate	31290289, 32198016
Aniridia	Associate	32422284
Anodontia	Associate	28578351, 35443723
Anophthalmia with pulmonary hypoplasia	Associate	29952716
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	37029297
Aortic Aneurysm Abdominal	Associate	35055064
Aortic Dissection	Associate	28415624, 36959563
Aortic Root Aneurysm	Associate	34346740
Aortic Valve Disease	Associate	23308213
Apparent mineralocorticoid excess	Associate	32355271
Argininosuccinic Aciduria	Associate	31796844
Aromatase deficiency	Associate	20101208
Arteriosclerosis	Associate	30338819
Arteriovenous Malformations	Associate	35343049
Arthritis	Associate	24385683, 37493406
Arthritis Gouty	Associate	36328206, 36994890
Arthritis Psoriatic	Associate	34576119
Arthritis Rheumatoid	Associate	11465707, 15642134, 17665439, 19709444, 20187936, 21862580, 24294360, 26819496, 27391352, 27729613, 27860244, 28090093, 30402834, 31028998, 31338093 View all (8 more)
Arthropathy progressive pseudorheumatoid of childhood	Stimulate	28137267
Ascites	Associate	19240722, 22306204, 31039761, 32390009
Asthma	Associate	30478434, 31412983, 34876240, 35069542, 36105239, 36354198, 37321621, 37904411, 40650018
Astrocytoma	Associate	19573808, 20423999, 21113787, 26286747, 37280243
Ataxia	Associate	32937819
Ataxia Telangiectasia	Associate	19152963, 20842106, 22739265, 27821800, 35782055
Atelosteogenesis type 1	Associate	35832491
Atherosclerosis	Associate	16269654, 17673673, 21070853, 24098801, 25110320, 27740938, 28341552, 29668625, 30915770, 32377692, 35463684, 37258122
Atresia of small intestine	Associate	24240591
Atrial Fibrillation	Associate	34841686, 36274100
Atrophy	Associate	16916907, 19351384, 21061022, 21900687
Autism Spectrum Disorder	Associate	29296277, 31551593, 36401485
Autistic Disorder	Associate	22558359, 29296277, 33564861
Autoimmune Diseases	Associate	27312110, 40141059
Autoimmune Lymphoproliferative Syndrome	Associate	27099149
Autonomic Nervous System Diseases	Associate	35778969
Barrett Esophagus	Associate	17559672, 30841855
Beckwith Wiedemann Syndrome	Associate	35507738
Behcet Syndrome	Stimulate	27701407
beta Thalassemia	Associate	29099866
Bicuspid Aortic Valve Disease	Associate	37108591
Biliary Tract Neoplasms	Associate	28544747, 33289918
Bipolar Disorder	Associate	17825267, 18395980, 19051289, 20132317, 20214684, 25726893, 27701407, 29484683, 31810747, 33765445
Birt Hogg Dube Syndrome	Associate	19850877
Blast Injuries	Associate	27903985
Blood Platelet Disorders	Associate	29436605, 30410927, 31163690, 39812346
Bone Diseases	Associate	19648884, 25793716, 31769620, 36134117
Bone Diseases Metabolic	Associate	26390436
Boomerang dysplasia	Associate	35832491
Brain Diseases	Associate	26345935, 28969385, 31639285, 36329890
Brain Edema	Associate	31574956
Brain Ischemia	Associate	25418580, 36254861
Brain Neoplasms	Associate	19573808, 20604919, 24133630, 24803579, 25269047, 25360740, 26410082, 26722465, 27694991, 33871399, 34499316
Breast Neoplasms	Associate	10424760, 10441522, 10542266, 11870534, 12048182, 12105188, 12631397, 12771144, 12838322, 12853346, 12954616, 12972603, 14602723, 14631376, 14704150 View all (526 more)
Breast Neoplasms	Inhibit	37209192
Bronchial Diseases	Associate	29749523
Brugada Syndrome	Associate	36881552
Burkitt Lymphoma	Associate	22241218, 22607709, 23603894, 26121143, 31300419, 31719683, 40021103
Cachexia	Associate	25238546, 28410220, 38354460
Cakut	Associate	39237660
Calcinosis	Associate	34162041
Calcinosis Cutis	Associate	16280046, 18822183, 24317053, 25510693, 27223432, 27435399, 32205016, 32611516, 32701605, 32811538, 34075774, 36788083, 38231165
Cancer Pain	Associate	35265311, 37852997
Cap Myopathy	Associate	18386291, 20530556
Carcinogenesis	Associate	12011061, 12070140, 12373610, 12511591, 12917336, 15150572, 15184909, 15353558, 15743786, 15851405, 15920558, 16254112, 16861905, 17360667, 17481480 View all (125 more)
Carcinoid Tumor	Associate	19588205, 19651067, 23147412
Carcinoma	Inhibit	11551917
Carcinoma	Associate	11959846, 21113787, 25475127, 26502919
Carcinoma Adenoid Cystic	Associate	17669465, 37947157
Carcinoma Adenosquamous	Associate	24481316, 26080840
Carcinoma Basal Cell	Associate	12445202, 19055754, 22082146, 23435205, 28573224, 30178853, 31128046, 33972406, 36788083
Carcinoma Ductal	Associate	19898424, 20808831, 20836878
Carcinoma Ductal Breast	Associate	20808831, 22689141, 28859163, 29848352, 30941989
Carcinoma Endometrioid	Associate	33377972
Carcinoma Giant Cell	Associate	35697931
Carcinoma Hepatocellular	Associate	10438468, 12679910, 12729898, 12896980, 16819163, 17609269, 17717605, 17996122, 18948272, 19261616, 19376776, 19445727, 21040406, 21512226, 21514425 View all (289 more)
Carcinoma in Situ	Associate	24840867, 32281236
Carcinoma Intraductal Noninfiltrating	Stimulate	16341149
Carcinoma Intraductal Noninfiltrating	Associate	19898424, 26718977
Carcinoma Large Cell	Associate	30793508, 30978501, 35331190
Carcinoma Lobular	Associate	26451490, 31018945, 32661241
Carcinoma Merkel Cell	Associate	22261808, 22363598, 26743471, 37311987
Carcinoma Mucoepidermoid	Associate	29419396, 33479203
Carcinoma Neuroendocrine	Associate	34247193, 36182960, 36653904
Carcinoma Non Small Cell Lung	Associate	12067477, 12649266, 15015570, 15265936, 15802268, 17342327, 18390835, 18520805, 19328625, 19671683, 19846969, 20008839, 20159991, 20447721, 21045158 View all (198 more)
Carcinoma Ovarian Epithelial	Associate	19240722, 19765303, 20661217, 23545606, 23708104, 24816687, 25307974, 25359618, 26261554, 26423401, 26716408, 26823830, 27118139, 27465688, 29996940 View all (8 more)
Carcinoma Pancreatic Ductal	Associate	18254976, 23437362, 25079376, 25120759, 25238546, 25905463, 26219899, 27230035, 28061880, 29526843, 30206226, 31731384, 32375296, 33051432, 34771150 View all (6 more)
Carcinoma Papillary	Associate	12733712, 15119004, 19898424, 24840867, 28830562
Carcinoma Papillary Follicular	Associate	20564403
Carcinoma Renal Cell	Associate	11551917, 15851405, 18283322, 18774962, 19061835, 19118035, 21269758, 21350947, 21644050, 21881486, 22950635, 22991494, 23139422, 23219378, 23433103 View all (81 more)
Carcinoma Small Cell	Associate	24980293, 25855050
Carcinoma Squamous Cell	Associate	15289499, 15920558, 19484147, 19625778, 21068757, 21407808, 22626691, 23196793, 24659658, 25426553, 25813410, 25855050, 26030731, 26080840, 26992219 View all (24 more)
Carcinoma Verrucous	Associate	30111295, 37658401
Carcinosarcoma	Associate	19389926, 28193280
Cardiofaciocutaneous syndrome	Associate	29158583
Cardiomegaly	Associate	17198778, 36046382
Cardiomyopathies	Associate	32460327, 35741813, 36435742
Cardiomyopathy Hypertrophic	Associate	12796566, 25708222
Cardiomyopathy infantile histiocytoid	Associate	25275525
Cardiotoxicity	Associate	29993192, 33474949, 36204517
Cardiovascular Diseases	Associate	26488172, 27740938, 28157227, 35908957
Cartilage Diseases	Associate	23460186, 24385683, 30569095, 32052902, 32322000, 37006311, 37493406
Cataract	Associate	31178586, 35179404
Celiac Disease	Associate	22785229
Cell Transformation Neoplastic	Associate	29587825, 35413842, 36102493, 38005222
Central Nervous System Infections	Associate	28097440
Central Nervous System Neoplasms	Associate	17506723
Central Nervous System Vascular Malformations	Associate	25722288, 35343049, 35355055
Cerebral Hemorrhage	Associate	36169245
Cerebral Infarction	Associate	33778069
Cerebral Palsy	Associate	33184298
Cerebrovascular Disorders	Associate	25849550
Charcot Marie Tooth Disease Recessive Intermediate A	Associate	34184201
Chemical and Drug Induced Liver Injury	Associate	38050247, 39930826
Cholangiocarcinoma	Associate	15855163, 17461449, 19147772, 19445727, 20012722, 20731018, 21874010, 23832540, 24757411, 26014518, 26260613, 26296968, 26823715, 27206490, 28178656 View all (17 more)
Cholangitis Sclerosing	Associate	29180269
Cholestasis	Associate	35196362
Cholesteatoma	Associate	24311896, 29559833, 34400892, 34522167, 34664835
Cholesteatoma Middle Ear	Associate	24311896, 34400892
Chondroma	Associate	28410203
Chondrosarcoma	Associate	23320110, 23874483, 23922104, 26168133
Chondrosarcoma Mesenchymal	Associate	35342947
Chordoma	Associate	19276265, 19401700, 26823799, 32011476
Choriocarcinoma	Associate	17167073, 24450273, 27922982, 28259870, 36464174
Chromosome 12 12p trisomy	Associate	34189564
Chromosome 1q21.1 Deletion Syndrome 1.35 Mb	Associate	25475127
Chronic Disease	Associate	34220309
Chronic Limb Threatening Ischemia	Associate	35199541
Chronic Periodontitis	Associate	31351582
Chronic Urticaria	Associate	32339669
Chronobiology Disorders	Associate	23028762
Cicatrix	Associate	29967566
Clear cell metastatic renal cell carcinoma	Associate	25962440, 27279483
Cleft Palate	Associate	35693826
Cognition Disorders	Associate	21775978, 21788944, 22525159, 23095849, 28050343, 30611996, 33765445, 36229517
Cognitive Dysfunction	Associate	23095849, 38039290
Colitis Associated Neoplasms	Associate	25569743, 26446703
Colitis Ulcerative	Stimulate	18045591
Colitis Ulcerative	Associate	33299870, 33432986, 35733095, 35966251, 36860851, 37960728, 39252247
Collagenoma Familial Cutaneous	Associate	24850616
Colonic Neoplasms	Associate	12417326, 16128748, 21722370, 25031754, 25301365, 25556496, 28811711, 30003723, 30683109, 33028966, 34477047, 35707003
Colorectal Neoplasms	Associate	12115344, 12140294, 15808505, 15970687, 16475687, 17276526, 17278192, 17640974, 18064605, 18283336, 18805444, 18931700, 19056378, 19351759, 19505918 View all (297 more)
Colorectal Neoplasms	Inhibit	23573286
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	35638907
Common Variable Immunodeficiency	Associate	32961022
Condylomata Acuminata	Associate	35131475
Congenital Abnormalities	Associate	29296277
Congenital bilateral aplasia of vas deferens	Inhibit	23308213
Congenital bilateral aplasia of vas deferens	Associate	32054096
Congenital Lipomatous Overgrowth Vascular Malformations and Epidermal Nevi	Associate	28502725, 34074347
Congenital Microtia	Associate	35346221
Connective Tissue Nevus	Associate	29042227, 35441778
Constriction Pathologic	Associate	36118676
Corneal Dystrophies Hereditary	Associate	24064688
Corneal Endothelial Cell Loss	Associate	30577658, 31835296, 34221236
Coronary Aneurysm	Associate	24490960
Coronary Artery Disease	Inhibit	31886261
Coronary Artery Disease	Associate	35801781
Coronary Disease	Associate	33849106, 35866783, 38013355
Cough	Associate	32131410, 34872267, 35866040
Cough	Inhibit	39465738
COVID 19	Associate	33140889, 33833618, 34752677, 34931923, 35069542, 35557984, 35855804, 36229517, 36817449, 37033923, 37347115, 37686182, 39684661
COVID 19	Stimulate	35008594
COVID 19 post intensive care syndrome	Associate	34752677
Cowden Like Syndrome	Associate	18678321, 23246288
Coxsackievirus Infections	Inhibit	25853521
Craniosynostoses	Associate	23073384, 35285136
Critical Illness	Associate	21483870
Crohn Disease	Associate	18045591
Cystadenoma	Associate	32014856
Cystic Fibrosis	Associate	28794469, 31664087, 32630830
Cystic Fibrosis	Inhibit	31813753
Cytokine Release Syndrome	Associate	34220309
Death	Associate	16245318, 21460616, 23640457, 24561578, 25238546
Degloving Injuries	Associate	26988277
Dementia	Associate	32471155
Dementia Multi Infarct	Associate	23317227, 24935396
Dementia Vascular	Associate	36451386
Dental Plaque	Associate	28214453
Depressive Disorder	Inhibit	25726893
Depressive Disorder	Associate	30196309, 31104012, 31477683, 37745719
Depressive Disorder Major	Associate	39312335
Dermatofibrosarcoma	Associate	35441365
Desmoplastic Small Round Cell Tumor	Associate	23922674
Developmental Disabilities	Associate	29296277, 37501076
Diabetes Complications	Associate	35757473, 35993048
Diabetes Gestational	Associate	22808198, 26302821, 28400911, 29298529, 35449053, 38497391
Diabetes Mellitus	Associate	16139132, 16339764, 20346323, 21521253, 21606676, 23862686, 23874686, 24255036, 24521217, 26683100, 27401534, 28157504, 29768267, 32600435, 35288456 View all (4 more)
Diabetes Mellitus	Stimulate	24797175, 35628588
Diabetes Mellitus Type 1	Associate	19654878, 28239651, 35784577, 36303457, 37468555, 39464889
Diabetes Mellitus Type 2	Associate	18395980, 21460183, 23344726, 23369358, 26178916, 26269521, 26386696, 28012244, 29768267, 30992506, 31332162, 32705173, 33788629, 34740995, 35046895 View all (6 more)
Diabetic Angiopathies	Associate	33537821
Diabetic Cardiomyopathies	Associate	33909697
Diabetic Nephropathies	Associate	24797175, 34840704, 36181090, 37063851, 38374020, 40312440
Diabetic Retinopathy	Associate	21686327, 25695094, 31432194, 35590353, 36465659, 38194422, 39348384
Diarrhea	Associate	28489509, 32312891
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	19887755
Diffuse Intrinsic Pontine Glioma	Associate	29207163
DiGeorge Syndrome	Associate	37872602
Digestive System Neoplasms	Associate	29259266
Disease	Associate	23810382, 26645682, 35832491, 36229517, 37872602
Disease Resistance	Associate	19143835, 24032744, 24457069, 26478515, 30353128
Dissection Ascending Aorta	Associate	34346740
Distal myopathy Nonaka type	Inhibit	26968811
DNA Virus Infections	Associate	26027929, 26225792
Down Syndrome	Associate	20059950, 23380710, 24735980, 25701644, 34200970, 35222360
Drug Related Side Effects and Adverse Reactions	Associate	11756412, 12062094, 12446787, 12738674, 12838322, 14762343, 15026413, 16868547, 18334673, 19671683, 20159991, 20447721, 20622048, 20704765, 20862547 View all (38 more)
Drug Related Side Effects and Adverse Reactions	Inhibit	17573715, 22338016, 40052893
Drug Resistant Epilepsy	Associate	26478515, 32785072, 35483878
Ductus Arteriosus Patent	Associate	33577028
Dupuytren Contracture	Associate	26018562
Dysequilibrium syndrome	Associate	36635778
Dyskinesia Drug Induced	Stimulate	12421823
Dyslipidemias	Associate	35899893
Dysplastic Nevus Syndrome	Associate	23554211, 28199128
Ectodermal Dysplasia	Associate	39424480
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Stimulate	19396006
Endocrine System Diseases	Associate	24467828, 26666173, 28874413, 30515568, 31710162, 33466512, 33816619
Endometrial Hyperplasia	Associate	19631369, 31452406
Endometrial Neoplasms	Associate	15016316, 15505622, 17150964, 17213663, 17924977, 18096667, 18615621, 19056846, 19107520, 19154413, 19234438, 19491896, 19775474, 19917135, 20087603 View all (62 more)
Endometrial Stromal Tumors	Associate	36731460
Endometriosis	Associate	19055724, 19074548, 22072736, 24064688, 24133578, 25194152, 31144476, 31273584, 31637941, 35401535, 38146657, 38364342, 39768828
Eosinophilic Esophagitis	Associate	36591238
Epilepsy	Associate	26345935
Epilepsy	Inhibit	27838154
Epilepsy Familial Mesial Temporal Lobe	Associate	27838154
Epilepsy Idiopathic Generalized	Inhibit	26537625
Epilepsy Temporal Lobe	Associate	29331082
Epstein Barr Virus Infections	Associate	26121143, 26701847, 29522278, 36075565
Erdheim Chester Disease	Associate	25150293
Erythema	Associate	34075774
Erythema elevatum diutinum	Associate	37603510
Esophageal Neoplasms	Associate	10908564, 19164214, 21467840, 24241346, 25211657, 26000878, 26050229, 26124180, 26317790, 26647768, 26828791, 27188433, 27239113, 27781415, 28548104 View all (20 more)
Esophageal Squamous Cell Carcinoma	Associate	21467840, 21689625, 21986133, 23114644, 25730371, 26191164, 26338103, 26828791, 27902974, 29463194, 29620226, 29867084, 30594787, 31558183, 31669361 View all (22 more)
Esophageal Squamous Cell Carcinoma	Stimulate	38320632
Essential Tremor	Associate	30570876
Exanthema	Associate	28489509, 31277699, 32312891, 33377972
Exfoliation Syndrome	Stimulate	32750756
Exostoses Of Heel	Associate	18423407
External Auditory Canal Bilateral Atresia Of With Congenital Vertical Talus	Associate	22551172
Facial Neoplasms	Associate	32014856
Fallopian Tube Diseases	Associate	37008951
Familial medullary thyroid carcinoma	Associate	31614935
Fatigue	Associate	31277699, 36373573
Fatigue Syndrome Chronic	Associate	31759091
Fatty Liver	Associate	29367738, 35013040, 35288456
Fatty Liver Alcoholic	Associate	37223041
Femur Head Necrosis	Associate	29510550
Fetal Growth Retardation	Associate	23639576, 30536700, 34995552, 35430618, 39929058
Fever	Associate	23558861, 33537819, 40724923
Fever	Stimulate	38350654
Fibrocartilaginous embolism	Associate	22990594, 24376640, 24603539, 27163878, 32036721, 33135363, 35464773, 36324122, 36578051, 37041597, 37603510, 38305591
Fibrolamellar hepatocellular carcinoma	Associate	24925055
Fibromatosis Aggressive	Associate	27062580, 32099073
Fibrosis	Associate	25149531, 26932461, 27829579, 30602778, 31527305, 34070150, 34275376, 34284400, 35176481, 35932042, 36064558, 37157945, 37179298
Fibrosis	Stimulate	31527305
Focal Cortical Dysplasia	Associate	25722288, 32785072
Focal cortical dysplasia of Taylor	Associate	26345935
Fractures Bone	Associate	32720595, 36749277
Fractures Spontaneous	Associate	37550343
Fragile X Syndrome	Associate	22268788
Fuchs' Endothelial Dystrophy	Associate	25363469
Gallbladder Neoplasms	Associate	24551272, 26287365, 26910892, 31752906, 34118139, 34184087, 35196196, 36546234
Gastritis Atrophic	Associate	26317520
Gastrointestinal Diseases	Associate	17330838, 36906972
Gastrointestinal Neoplasms	Associate	21042278, 25031754, 32863943, 35705314
Gastrointestinal Stromal Tumors	Associate	16707477, 18521081, 18550829, 25898773, 27469332, 29902839, 30537795, 30551450, 30887595, 31553483, 33266502, 34738628, 36921738, 36966336
GATA2 Deficiency	Associate	19641183, 19965620, 22922206, 25907832, 32321919
Germinoma	Associate	27391150
Giant Cell Tumor of Tendon Sheath	Associate	33994368
Gingival Diseases	Associate	31743516, 33934404
Glaucoma	Associate	31680442
Glioblastoma	Associate	11756412, 14655756, 14701753, 15605984, 15808505, 16199861, 16740698, 16923165, 17002787, 17513297, 17697526, 18567800, 18804099, 19458076, 19461960 View all (119 more)
Glioma	Associate	12388552, 15184909, 15197348, 15711939, 16103081, 16461357, 16530701, 17360667, 19048112, 19176518, 19252415, 19543319, 19661320, 19671762, 19705067 View all (136 more)
Glioma of Brain Familial	Associate	22938480
Gliosarcoma	Associate	14655756, 28193280, 34856571
Glomerulonephritis IGA	Associate	20485333, 27730700
Glucocorticoid Receptor Deficiency	Associate	31318944
Glucose Intolerance	Associate	20872231, 33967958
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417, 29963728, 33521822, 36434592
Glut1 Deficiency Syndrome	Associate	20568281, 36558058
Glycogen Storage Disease Type IV	Associate	31941945
Glycosuria Renal	Associate	38033740
Gout	Associate	36123941
Granulomatous Disease Chronic	Associate	8879195
Granulosa Cell Tumor	Associate	26137586
Graves Disease	Associate	24840811, 37859983
Graves Ophthalmopathy	Associate	23092922, 31622470, 33488522, 34269815, 39619202
Growth Hormone Secreting Pituitary Adenoma	Associate	31165412
HAIR AN syndrome	Associate	23543667, 34718921
Hallucinations	Associate	31810747
Hamartoma Syndrome Multiple	Associate	12844284, 14566704, 14675182, 14985374, 18678321, 22962422, 23246288, 24743220, 31350329, 35290761, 36011318
Hamartoma Syndrome Multiple	Inhibit	22962422, 25527629
Harlequin type ichthyosis	Associate	20011249
Hashimoto Disease	Associate	17481480
Head and Neck Neoplasms	Associate	22577058, 23115635, 23408298, 24245510, 26666511, 26895469, 30642292, 32628350, 32669614, 33919657, 34247193, 34344926, 39684472, 39695576
Heart Defects Congenital	Associate	32590727
Heart Diseases	Associate	32460327, 34612779
Heart Failure	Associate	17885560, 21098579, 32460327, 34275376, 35128826
Heart Failure	Inhibit	21193562
Helicobacter Infections	Associate	21841827, 26317520, 30796154
HELLP Syndrome	Associate	37950229
Hemangioendothelioma	Associate	33377124
Hemangioma	Associate	23298485, 24704994, 30584986
Hemangioma capillary infantile	Associate	39286286
Hemangiosarcoma	Associate	22648906
Hematologic Diseases	Associate	31726910, 36906972
Hematologic Neoplasms	Associate	16645590, 23380710
Hematuria Benign Familial	Associate	26884885
Hemihyperplasia Isolated	Associate	25915946
Hemimegalencephaly	Associate	22500628, 25722288, 35441233
Hemochromatosis	Associate	23761422
Hemolytic Uremic Syndrome	Associate	37795100
Hepatitis B	Associate	26919045, 30111572, 30209179, 36052278
Hepatitis C	Inhibit	17131467, 25645159
Hepatitis C	Associate	27252525, 35712812, 37223041
Hepatitis C Chronic	Associate	32050950
Hepatitis D	Associate	32961022
Hepatoblastoma	Associate	30809316, 31541079, 33780361, 34996511, 35507738
Hereditary Angioedema Type III	Associate	34073781
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20101210, 21574647, 22460814, 23620408, 23895914, 24811059, 26577839, 29453318, 29739933, 30394935, 32088208, 32393308, 36916425, 37736741, 40437613
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	37181035
Hereditary leiomyomatosis and renal cell cancer	Associate	16412023, 9834235
Hereditary pancreatitis	Associate	12011061
Hereditary Sensory and Motor Neuropathy	Associate	17440983
Heredodegenerative Disorders Nervous System	Associate	36183486
Herpes Simplex	Associate	34308964
Hirschsprung Disease	Associate	30062828, 36214716
Histiocytoma Malignant Fibrous	Associate	21208094
HIV Infections	Associate	21410942, 27076174, 28892135, 33643305, 37204043
Hodgkin Disease	Associate	16412023, 22343918, 27870927, 30610809, 31128034, 36831273
Holt Oram syndrome	Associate	32580247
Huntington Disease	Associate	12062094, 28973411
Hydatidiform Mole	Associate	38409834
Hyperaldosteronism	Associate	23626817
Hyperglycemia	Associate	15964918, 18725974, 25385439, 28489509, 32312891, 33377972, 33967958
Hyperglycemia	Inhibit	18599614, 31828164
Hyperglycemia	Stimulate	34299331
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	25849290
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	34299331
Hyperinsulinism	Associate	33967958
Hyperkeratosis Epidermolytic	Associate	37929023
Hyperlysinemias	Stimulate	34068442
Hyperostosis	Associate	27550858
Hyperoxia	Associate	26196743
Hyperoxia	Inhibit	33215223
Hyperphosphatemia	Inhibit	21858050
Hyperplasia	Associate	14767488, 33114687, 35805203, 37302654
Hypertension	Associate	14611643, 37154169
Hypertension Pregnancy Induced	Associate	29381395
Hypertensive Retinopathy	Associate	37105761
Hypertrophy	Associate	21061022, 22879939, 28951244, 33416124, 34650188
Hyperuricemia	Associate	29317200, 36123941
Hypoglycemia	Associate	22729222
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	29258102
Hypomagnesemia primary	Associate	27876891
Hypopharyngeal Neoplasms	Associate	30535507
Hypophosphatemia	Stimulate	21858050
Hypothalamic hamartomas	Associate	25307426
Hypoxia	Stimulate	12482504, 15220111, 15987743, 17158959, 18976673, 19036873, 19919574, 20920536, 21408136, 23145312, 23558942, 25860915, 26078356, 27581620, 30755508 View all (6 more)
Hypoxia	Associate	12495471, 12764143, 16014625, 18351386, 19328625, 19473970, 21048308, 21499308, 22245152, 23545606, 23696831, 25166211, 25562170, 25596742, 25849550 View all (35 more)
Hypoxia	Inhibit	18566221, 24905002, 29843131
Hypoxia Brain	Associate	12764143, 17337592, 19036873, 19265129, 23966163, 24423919, 25961449, 25961455, 30244253, 30755508, 31364726, 31796646, 31941116, 36080483, 36254861, 39682777 View all (1 more)
Hypoxia Brain	Stimulate	20395290, 23558942, 24347249
Hypoxia Brain	Inhibit	34269814
Hypoxia Ischemia Brain	Associate	38015765
Ichthyosis Vulgaris	Associate	37960775
Idiopathic Pulmonary Fibrosis	Associate	20061390, 20109444, 21893017, 23580232, 24728102, 26138239, 27218286, 27769060, 29144435, 29563341, 29568927
IgA Vasculitis	Associate	17599743, 31498070, 36389115
Ige Responsiveness Atopic	Associate	21625490
Immune System Diseases	Associate	37029297
Immunodeficiency without anhidrotic ectodermal dysplasia	Associate	25831047
Immunologic Deficiency Syndromes	Inhibit	26196743
Immunologic Deficiency Syndromes	Stimulate	34673575
Impotence Vasculogenic	Associate	28699701, 31936664, 36055752, 36418859
Infarction Middle Cerebral Artery	Associate	28640835
Infections	Associate	17121804, 19480971, 21918972, 22613768, 24422998, 25916549, 26487493, 31658294, 35222360
Infertility	Associate	36303457, 36369952
Inflammation	Associate	12052830, 15265936, 18204201, 19404300, 20649564, 21430300, 21637825, 22306153, 22307621, 22689577, 23264659, 23646189, 23704966, 23797008, 24098801 View all (90 more)
Inflammation	Inhibit	34666758
Inflammatory Bowel Diseases	Associate	21637825, 25569743, 25927528
Inflammatory Bowel Diseases	Stimulate	29180269
Inflammatory Breast Neoplasms	Associate	22858377
Influenza Human	Associate	24752266, 37631988
Infratentorial Neoplasms	Associate	33902636
Insulin Resistance	Associate	15339744, 17131467, 17227768, 18160431, 18364460, 18443205, 20872231, 21061022, 21297971, 22721429, 22970944, 23344726, 25645159, 26386696, 26604643 View all (24 more)
Insulin Resistance	Inhibit	22403297, 29955086
Insulinoma	Associate	18061583, 34503515
Intellectual Disability	Associate	32014856
Intervertebral Disc Degeneration	Associate	24376640, 24603539, 31746390, 32271398, 32271399, 32901877, 34382895, 34554926, 34974804, 36746221, 37603510
Intervertebral disc disease	Associate	21590431, 35960059
Intervertebral Disc Displacement	Associate	21590431
Intestinal Neoplasms	Associate	24260544
Intestinal Polyposis	Associate	38297356
Intra Articular Fractures	Associate	35426265
Intracranial Aneurysm	Associate	28338184
Irritable Bowel Syndrome	Associate	25927528
Ischemia	Associate	17167073, 26742633, 35422072, 37157945
Ischemia	Inhibit	22204954, 33000275
Kashin Beck Disease	Associate	25433273, 29514696, 30153510, 32816579, 40449756
Keloid	Associate	31545402
Keratoconus	Associate	25247416, 28902914, 29860458
Keratosis Seborrheic	Associate	21078999
Kidney Diseases	Associate	11918736, 34326314
Kidney Failure Chronic	Associate	35908957
Kidney Neoplasms	Associate	19850877, 22685542, 24175769, 24797175, 25016284, 25149531, 25757764, 26633711, 27226530, 27460078, 28713889, 29424922, 30003754, 30840265, 31002126 View all (5 more)
Klatskin Tumor	Associate	20145951, 24312291, 37937607
Klippel Trenaunay Weber Syndrome	Associate	35343049
Knee Injuries	Associate	32014856
Kniest dysplasia	Associate	32088208
Larsen Syndrome	Associate	35832491
Laryngeal Neoplasms	Associate	25008564, 25120770, 32096156, 32633370, 33415169
Laryngitis	Associate	24980293
Leiomyoma	Associate	18439583, 19464003, 19772960, 24476133, 27748285, 30292626, 31159158, 32892998, 34224241, 36771423
Leiomyosarcoma	Associate	21326806, 23532091, 29258902, 33377972
Lentigo	Stimulate	25917897
LEOPARD Syndrome	Associate	25708222, 25917897
Leukemia	Associate	15494423, 15782127, 15860672, 17673311, 17928528, 18414037, 19375649, 19406989, 19641183, 19661292, 19773546, 19880494, 19883517, 20007139, 21828124 View all (34 more)
Leukemia	Stimulate	33649851
Leukemia B Cell	Associate	15591113, 31387192
Leukemia Biphenotypic Acute	Associate	25313141, 33390793
Leukemia Large Granular Lymphocytic	Associate	16484592, 19880494, 23667543
Leukemia Lymphocytic Chronic B Cell	Associate	15618220, 17928528, 19713228, 19815839, 20544350, 20622048, 20661426, 20668475, 20809501, 21307146, 22351695, 22569400, 22875913, 23505068, 24334291 View all (12 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	20018914
Leukemia Lymphocytic Chronic B Cell	Inhibit	27815263
Leukemia Lymphoma Adult T Cell	Associate	16630125, 17576198, 20215110, 25488980, 26269411, 26436088, 34995552
Leukemia Megakaryoblastic Acute	Associate	19638627, 23380710
Leukemia Monocytic Acute	Associate	23940660
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15556610, 19261608, 20200561, 20704577, 21368869, 21887305, 22833150, 23180012, 24603487, 26460262, 26722450, 28452984, 28631564, 28639894, 35674911, 37786778 View all (1 more)
Leukemia Myeloid	Associate	15665116, 26496029, 27035679, 33439746
Leukemia Myeloid Acute	Associate	11745387, 15289327, 15840695, 16304046, 17179228, 17259349, 17878402, 18160664, 19010914, 20007139, 20810927, 21660042, 22407228, 22828407, 23320091 View all (49 more)
Leukemia Prolymphocytic T Cell	Associate	17890451, 19751240, 27469405, 31216925
Leukemia Promyelocytic Acute	Associate	12027902, 26397153, 27840989, 30536958
Leukemia T Cell	Associate	15287952, 18053070, 18830414, 19461960, 22491738, 23047954, 35345960
Leukoencephalopathy Progressive Multifocal	Associate	28768870, 34831441
Lewy Body Disease	Associate	32887355
Leydig Cell Tumor	Associate	32180008
Lichen Planus Oral	Associate	30664152
Light Fixation Seizure Syndrome	Associate	32973329, 36011318
Lipid Metabolism Disorders	Associate	36994890
Lipoma	Associate	35290761
Lipomatosis Multiple Symmetrical	Associate	33114687
Liposarcoma	Associate	24695632, 26518767, 33114687
Liposarcoma Myxoid	Associate	20522586, 22020193, 35672466
Liver Cirrhosis	Associate	28691020, 30326962, 36246566
Liver Cirrhosis Biliary	Associate	17599743
Liver Diseases	Stimulate	25537506
Liver Failure	Associate	35236826
Liver Neoplasms	Stimulate	25537506
Liver Neoplasms	Associate	35236826, 37542825
Loeys Dietz Syndrome	Associate	26617788, 34346740
Lower Extremity Deformities Congenital	Associate	20538844
Lower Urinary Tract Symptoms	Associate	28855187
Lown Ganong Levine Syndrome	Associate	25426553
Lung agenesis	Associate	29328793
Lung Diseases	Associate	26468985, 26572277, 29328793, 31527305, 32327430, 32457348, 33140889, 34409758
Lung Injury	Associate	33140889
Lung Neoplasms	Associate	12511591, 12529380, 14762343, 15642728, 16648865, 17032498, 17150102, 18483303, 18566221, 18676680, 19090006, 19176399, 19337377, 19351834, 19568240 View all (130 more)
Lupus Erythematosus Systemic	Stimulate	23125486, 29762839
Lupus Erythematosus Systemic	Associate	23735868, 23896866, 25989537, 29884225, 31536674, 32576231, 35543435, 36482627, 37585411, 39563449
Lupus Nephritis	Associate	23896866, 25339666, 37099456
Lymphangioleiomyomatosis	Associate	19717640
Lymphatic Metastasis	Associate	12115344, 16254112, 17278192, 20808831, 24133589, 25702787, 25855050, 26317520, 27096956, 27188433, 29743718, 32281236, 32750756, 33911067, 35616137, 36982542, 37184125, 38211648 View all (3 more)
Lymphatic Metastasis	Stimulate	31436252, 32023262
Lymphedema	Associate	25424831, 30947262, 34170046, 35806420
Lymphoblastic Transformation Inhibition of	Stimulate	36117171
Lymphoma	Associate	21987722, 23603894, 25590803, 26585955, 27390358, 31123343, 34382383, 34948236, 35184749, 39735560
Lymphoma B Cell	Associate	15331441, 18334673, 18628489, 20067536, 29515122, 29522278, 31601188, 36691066
Lymphoma B Cell Marginal Zone	Stimulate	14630827
Lymphoma Follicular	Associate	22102710, 25096023, 33419778
Lymphoma Large B Cell Diffuse	Associate	15331441, 16946303, 19036086, 20201946, 21931821, 22338016, 22609116, 23360303, 23580656, 23764004, 23840064, 24356628, 24418330, 25909227, 26585955 View all (12 more)
Lymphoma Large Cell Anaplastic	Associate	15374880, 16818631, 22488797, 25987255
Lymphoma Mantle Cell	Associate	16098065, 16645163, 16925576, 17148679, 17606765, 18339899, 19708031, 20844237, 22107151, 22361516, 23079699, 23360303, 25082755, 25216518, 27123851, 30964854, 31498006, 36719376 View all (3 more)
Lymphoma Non Hodgkin	Associate	19705067, 25724300, 26578780, 26823817, 34841595, 38022677
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	34382383
Lymphoma Primary Effusion	Associate	20074295, 22768179, 26575168, 31787726
Lymphoma T Cell	Associate	27494022, 33152759
Lymphoma T Cell Cutaneous	Associate	16645590, 30194255, 34360654, 35787399, 38223508
Lymphoma T Cell Peripheral	Associate	25674239, 30782609
Lymphoproliferative Disorders	Associate	36254040
Lysosomal Storage Diseases	Associate	22259051
Macular Degeneration	Associate	23441106, 34341398, 34823219
Malformations of Cortical Development	Associate	28969385, 29679388
Malformations of Cortical Development Group I	Associate	23193212, 27534371, 29070760, 33393627, 34435521, 36237735
Malnutrition	Stimulate	31992313
Malnutrition	Associate	36324122
Mammary Neoplasms Animal	Associate	18270579, 27629725
Mandibular Nerve Injuries	Associate	35354377
Mastocytosis Systemic	Associate	19747364
Medulloblastoma	Associate	17039417, 19887560, 20053726, 22212915, 22313636, 22402744, 22411914, 25052069, 25475127, 30244244, 35315927, 35419951, 35593307, 35866054
Megalancephaly Polymicrogyria Polydactyly Hydrocephalus Syndrome	Associate	28502725
Megalencephaly	Associate	24497998, 24939587, 25722288, 25915946, 28086757, 28969385, 29296277, 31290289, 31639285, 34170046, 35483878, 35551640, 38141607
Megalodactyly	Associate	23100325, 32014856, 33054853
Melanoma	Associate	12606824, 15580309, 15987743, 16470169, 16861905, 17070520, 17640227, 18323781, 18813315, 18984162, 19078992, 19088048, 19593429, 20164843, 20216471 View all (83 more)
Melanoma Cutaneous Malignant	Associate	20959481, 31173492, 35504869, 36043142
Membranous Obstruction of Inferior Vena Cava	Associate	32014856
Meningeal Carcinomatosis	Associate	28193280
Meningioma	Associate	17181554, 23334667, 25247996, 25269047, 25993161, 26826201, 27102344, 27548314, 27550858, 28082415, 28376212, 28610844, 28923059, 29424888, 31857543 View all (5 more)
Meningioma	Stimulate	23285163
Mental Disorders	Associate	20132317, 21949775
Mesangial sclerosis diffuse	Associate	11918736
Mesothelioma	Associate	16077404, 16123394, 17311837, 18511708, 19460788, 21294125, 21701776, 22065079, 24722292, 24762959, 31033201, 31670317
Mesothelioma Malignant	Associate	16077404, 18606715, 21124760, 23817184, 28704762, 28960945, 32708306, 37083070
Metabolic Diseases	Associate	35216514
Metabolic Syndrome	Associate	20872231, 21061022, 23344726
Mevalonate Kinase Deficiency	Associate	38636615
Microcephaly	Associate	37501076
Microsatellite Instability	Associate	31292272
Microscopic Polyangiitis	Associate	37029297
Microvascular Angina	Associate	37390241
Migraine Disorders	Associate	33178826
Mitochondrial Diseases	Associate	15782127, 16141349, 20338993, 22393246, 23441106, 25980443, 27367669, 28383489, 28426671, 28930531, 32630532, 36457007, 36625318, 37058031
Mohr Tranebjaerg syndrome	Associate	24108762, 32400857
Monoclonal Gammopathy of Undetermined Significance	Stimulate	24816239
Mood Disorders	Associate	17825267
Mouth Neoplasms	Associate	23554211, 23799155, 23806066, 26191149, 28099936, 29037125, 30941988, 32277652, 32695810, 33099948, 33921647, 34268996, 34318593, 35225439, 36072619, 39201464 View all (1 more)
Mucolipidoses	Associate	22460814
Multi centric Castleman's Disease	Associate	31408438
Multiple Myeloma	Associate	11675360, 12391322, 12433678, 15319277, 15470037, 16118318, 16234364, 16418332, 16627469, 16728278, 16818641, 17644731, 18499442, 18635812, 19446321 View all (30 more)
Multiple Myeloma	Inhibit	24816239
Multiple Myeloma	Stimulate	27559096
Multiple Sclerosis	Associate	24155968, 27312110, 35049167, 36341423
Multiple Sclerosis Relapsing Remitting	Associate	30743997
Muscle Neoplasms	Associate	21098579
Muscle Spasticity	Associate	32937819
Muscular Atrophy	Associate	21478156, 25460913, 35565825, 35605642, 35736168
Muscular Dystrophy Duchenne	Stimulate	36814107
Myasthenia Gravis	Associate	37498332
Mycobacterium Infections Nontuberculous	Associate	22613768
Mycosis Fungoides	Associate	25811617, 30125933
Myelodysplastic Syndromes	Associate	11861273, 23047954, 25472472, 26521017, 30015844, 37986081
Myelodysplastic Syndromes	Inhibit	31756785
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	11918736
Myeloproliferative Disorders	Associate	23380710
Myocardial Infarction	Associate	20132317, 20467748, 34079221
Myocardial Infarction	Stimulate	34275376
Myocardial Ischemia	Associate	35199541, 36546685
Myocardial Stunning	Associate	25459138
Myofibrillar Myopathy	Associate	34830320
Myopathies Structural Congenital	Associate	21478156
Myopathies Structural Congenital	Stimulate	37658050
Myopathy with Giant Abnormal Mitochondria	Associate	36525817
Myostatin related muscle hypertrophy	Associate	16916907, 35704697
Myotonic Dystrophy	Associate	28915272, 36230978, 36767649
N syndrome	Associate	38364342
Nasal Polyps	Associate	32047813, 35572732, 35747690
Nasopharyngeal Carcinoma	Associate	19756373, 22116667, 22610073, 23573286, 23755163, 23838801, 23987636, 24386352, 24606633, 24632578, 24845412, 25165983, 25482932, 25607111, 26339346 View all (51 more)
Nasopharyngeal Carcinoma	Stimulate	21059916
Nasopharyngeal Neoplasms	Associate	23838801, 26499488, 31786875, 32400857, 36644819
Nausea	Associate	26931343
Necrosis	Associate	34576119
Neoplasm Invasiveness	Associate	26700664, 27030265, 27661110, 29952249, 32152520, 35877198
Neoplasm Metastasis	Associate	14680486, 16245318, 17825284, 18283322, 18386830, 18472958, 18475308, 18942118, 19018257, 19288574, 19487299, 19573813, 19648884, 20110378, 20444703 View all (198 more)
Neoplasm Metastasis	Stimulate	24362520
Neoplasm Recurrence Local	Associate	24018125
Neoplasms	Associate	10051603, 10400703, 10579725, 10691731, 11145953, 11340084, 11477064, 11504915, 11571628, 11756412, 11799112, 11896207, 12011061, 12067477, 12095980 View all (1079 more)
Neoplasms	Inhibit	14631376, 19797085, 20495538, 23633104, 23693014, 24517182, 24599934, 25854175, 26845446, 28114950, 28301567, 29577611, 34535749, 35179782
Neoplasms	Stimulate	22245726, 23133538, 24282295, 24743574, 25537506, 28077784, 28860563, 29292163, 29668670, 30720164, 31253108, 33503805, 36647832, 37823778
Neoplasms Adipose Tissue	Associate	38354460
Neoplasms Bone Tissue	Associate	35441778
Neoplasms Germ Cell and Embryonal	Associate	24896186, 29410498
Neoplasms Glandular and Epithelial	Associate	34898367, 36535331
Neoplasms Neuroepithelial	Associate	31984581
Neoplasms Second Primary	Associate	22577058
Neoplasms Squamous Cell	Associate	25348954, 29103201, 31257524, 34814915
Neoplastic Cells Circulating	Associate	28358430
Neoplastic Syndromes Hereditary	Associate	14985374
Nephrolithiasis Calcium Oxalate	Associate	40191870
Nephrotic Syndrome	Associate	35837376, 37478256
Nerve Degeneration	Inhibit	12062094
Nerve Degeneration	Associate	22739265, 30935413, 31885368, 33443209, 36372373
Neural crest tumor	Associate	27438149
Neural Tube Defects	Associate	17898317, 33491544
Neuralgia	Associate	35354377
Neurilemmoma	Associate	16571745, 19409384
Neurilemmoma	Stimulate	22247700
Neuroblastoma	Associate	12000752, 15255949, 15485492, 15849504, 15972965, 16133873, 17156427, 17379415, 18278068, 18281552, 18325115, 19278624, 19726747, 20490331, 20564403 View all (24 more)
Neurocytoma	Associate	38609519
Neurodegenerative Diseases	Associate	15026413, 28383489, 36229517, 40141059
Neuroendocrine Tumors	Associate	19588205, 19669229, 23676460, 24126619, 25076292, 26965582, 27994516, 31129920, 32611516, 36899368, 40390063
Neurofibromatosis 2	Associate	23348505, 32070062
Neurofibrosarcoma	Associate	19246520, 22259051, 24341609, 25474318
Neuroinflammatory Diseases	Associate	36005538, 36169245, 37922650
Neuroma Acoustic	Associate	20856158, 21697181, 30953268
Neurotoxicity Syndromes	Associate	29286349, 29334833, 33922144, 36169245, 36906972, 38487884
Nevus	Associate	17640227
Nevus Epithelioid and Spindle Cell	Associate	17640227
Nevus Pigmented	Associate	27015094
Niemann Pick Disease Type C	Associate	27876891, 32281513, 34604387
Non alcoholic Fatty Liver Disease	Associate	30948912, 35469222, 36451177, 37861538, 39183055, 39962463
Non functioning pancreatic endocrine tumor	Associate	19917848
Non Muscle Invasive Bladder Neoplasms	Associate	20530239, 32449441, 32786144
Non Muscle Invasive Bladder Neoplasms	Stimulate	23084634
Non Radiographic Axial Spondyloarthritis	Associate	36543524
Obesity	Stimulate	17559672
Obesity	Associate	21097644, 21460183, 23344726, 24521217, 25108739, 26386696, 27314662, 28316325, 29367689, 35288456, 35937803, 37004031, 37286617, 37697228
Obesity	Inhibit	27481183
Oculocerebrorenal Syndrome	Associate	19011679
Oculodigitoesophagoduodenal syndrome	Associate	37391760
Odontogenic Tumors	Associate	27066764
Odontoma	Associate	32711543
Oligodendroglioma	Associate	37533228
Oral Submucous Fibrosis	Associate	33345447, 37157945
Orbital Diseases	Associate	35814499
Oropharyngeal Neoplasms	Associate	23852799
Osteitis Deformans	Associate	26848537
Osteoarthritis	Associate	19302240, 21324373, 22662110, 22954457, 23460186, 26972586, 27669541, 29255496, 30081074, 30451865, 30505322, 31460867, 31652455, 31886203, 33118610 View all (12 more)
Osteoarthritis Knee	Associate	32052902
Osteoglophonic dwarfism	Associate	32096202, 32124937, 33206286, 36372373
Osteoglophonic dwarfism	Inhibit	35609324, 36254861
Osteolysis Essential	Associate	35668402
Osteonecrosis	Associate	31702033
Osteoporosis	Associate	25815782, 26914116, 29158773, 34142171, 34743649, 34799880, 35069454, 38159253, 39213112, 40080935
Osteosarcoma	Associate	17218775, 19670450, 21686164, 23372675, 23740448, 24014087, 24132591, 24175786, 24391455, 24447333, 24595049, 24835790, 25261470, 25371071, 25431257 View all (61 more)
Osteosarcoma	Stimulate	40676084
Otitis Media	Associate	19638206
Ototoxicity	Associate	37088824
Ovarian Diseases	Associate	15337760, 18450971, 27819360, 37317923, 37883761, 38321265
Ovarian Neoplasms	Associate	11395387, 12087097, 15028555, 15337760, 16002410, 16983702, 17070899, 17218783, 17322388, 17459055, 18075302, 18201274, 18283299, 18353772, 18392055 View all (164 more)
Overweight	Inhibit	27481183
Pain	Associate	29749446, 35334511
Pancreatic Carcinoma	Associate	38291468
Pancreatic Intraductal Neoplasms	Associate	24132918, 35834096, 40317966
Pancreatic Neoplasms	Associate	12495471, 12865934, 14647146, 17342093, 17457047, 18783292, 19050262, 19435822, 20630061, 20663861, 20686216, 20697673, 20726858, 20848249, 21118808 View all (83 more)
Pancreatic Neoplasms	Stimulate	24248418, 38521069
Pancreatitis	Associate	17310129, 33577028, 36218109
Papilloma	Inhibit	12865943
Papilloma	Associate	19898424, 29454754
Papilloma Intraductal	Associate	35441778
Papilloma Inverted	Associate	29040365, 37891239
Papillomavirus Infections	Associate	33123313, 37204043
Paraneoplastic Syndromes	Associate	25120759, 30170375
Parathyroid Neoplasms	Associate	28352668
Parkinson Disease	Associate	18395980, 21177249, 24559646, 30640362, 33443209, 34204164, 34520759, 36237735, 37446291, 38062843, 40141059
Parkinson Disease Secondary	Associate	15026413
Parotid Neoplasms	Associate	33377972
Pelvic Organ Prolapse	Associate	27176043, 34432732
Penile Neoplasms	Associate	21407808, 29902261
Periodic fever familial autosomal dominant	Associate	29740162, 33073595
Periodontal Diseases	Associate	36566872
Periodontitis	Associate	32520926, 34200970, 34213019, 37047340, 39904707
Perisylvian syndrome	Associate	26520804
Peritoneal Neoplasms	Associate	37639911
Peritonitis	Associate	27572739, 27661110
Perivascular Epithelioid Cell Neoplasms	Inhibit	17521703
Personality Disorders	Associate	23681745, 29749446, 36609600
Peutz Jeghers Syndrome	Associate	31107726, 36011318
Pharyngeal Neoplasms	Associate	23867201
Phenylketonurias	Associate	29358461
Pheochromocytoma	Associate	19669229, 29159601
Philadelphia Chromosome	Associate	30642353, 34403880
Phyllodes Tumor	Associate	37240386
Pituitary Neoplasms	Associate	27465551, 28288092, 35247260
Placenta Diseases	Associate	34220309
Plasmablastic Lymphoma	Associate	34714908
Plasmacytoma	Associate	25897806
Pneumonia	Stimulate	22795649
Pneumonia	Associate	30280794, 33971977
Poikiloderma with Neutropenia	Inhibit	32580297
Polycystic Kidney Autosomal Recessive	Associate	24851866
Polycystic Kidney Diseases	Associate	34469896
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Associate	33765445
Polycystic Ovary Syndrome	Associate	19631369, 23493574, 26373822, 31452406, 33287836, 34480296, 35032287, 36209087, 37737665, 39253602, 39284759
Polycythemia Vera	Associate	15676208, 16384930, 19815050, 30570876, 34059095
Polyendocrinopathies Autoimmune	Associate	29237911
Polymicrogyria	Associate	28969385
Polyposis Syndrome Hereditary Mixed 1	Associate	18351386
Poroma	Associate	23056620
Pre Eclampsia	Associate	24944161, 29381395, 29428958, 32572896, 36702079, 37642261
Precancerous Conditions	Associate	30183087, 31389121, 32107418, 32645661, 34408201, 35686033, 40004462
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	35794338, 36674872
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17537996, 18599181, 24244612, 24561792, 27821800, 30575921, 31042587, 31318944, 34403880, 34711640, 36674872, 37867416
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15287952, 15327518, 16115127, 17107349, 18053070, 18373709, 18392055, 18414037, 18665177, 18830414, 19340001, 19351820, 19406988, 19436302, 19458356 View all (24 more)
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	16956345
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	34670357
Primary Immunodeficiency Diseases	Associate	32961022
Primary Myelofibrosis	Associate	21725052, 27341078, 30570876
Primary Ovarian Insufficiency	Associate	27571179, 35248053, 36434569, 37460774
Prolactinoma	Associate	30445560, 35721701
Prostate cancer familial	Associate	18829572, 34670536
Prostatic Hyperplasia	Associate	25631101, 30295140, 34100062
Prostatic Intraepithelial Neoplasia	Associate	25360740
Prostatic Neoplasms	Associate	10419456, 10753955, 11461904, 12063252, 12482965, 12738789, 14523021, 14645548, 14985354, 15548330, 15720812, 16007172, 16061480, 16168126, 16186112 View all (213 more)
Prostatic Neoplasms Castration Resistant	Associate	18349820, 20606040, 25252916, 25360799, 25943311, 26603105, 27249694, 27323416, 29989268, 31228231, 31874108, 32205016, 32630532, 34698359, 37047425, 37732622 View all (1 more)
Prostatitis	Associate	10716737, 17534446, 18350153, 19107816, 20501799, 21840483, 25360740, 32102520, 33426070, 35693826
Proteinuria	Associate	22218591
Proteus Syndrome	Associate	21793738, 24850616, 26657992, 27112325, 27550858, 28502725, 28627093, 29549527, 30346092, 30803705, 31371346, 31490637, 31692258, 32014856, 32035943 View all (9 more)
Pseudomyxoma Peritonei	Associate	26475379, 37768171
Psoriasis	Associate	34992498, 37935955
Psychological Distress	Associate	24476133, 30664154, 35552173
Psychoses Substance Induced	Associate	22525159
Psychotic Disorders	Associate	19051289, 21775978, 22525159
Pterygium	Associate	30967746
Pulmonary Arterial Hypertension	Associate	21498912, 22688668, 28428963, 28655554
Pulmonary Arterial Hypertension	Stimulate	30274147
Pulmonary Disease Chronic Obstructive	Associate	20381852, 25339614, 30280794, 33116468, 35134750, 37180749, 40332792
Pulmonary Disease Chronic Obstructive	Inhibit	22383663
Pulmonary Fibrosis	Associate	19520917, 31527305, 34080651
Pulmonary Sclerosing Hemangioma	Associate	27601661
Purpura Thrombocytopenic Idiopathic	Associate	30337485, 36800582, 38184203
Pyruvate Carboxylase Deficiency Disease	Associate	33458757
Radiation Injuries	Associate	27624978
Radiation Pneumonitis	Associate	26645682, 34964782
Rectal Neoplasms	Associate	21910869, 31702045, 34256782
Renal Insufficiency Chronic	Associate	21228768, 33069430, 36860851, 37510393
Reperfusion Injury	Associate	29532851, 29996122, 33241954, 34184201, 36596364
Respiration Disorders	Stimulate	17158959
Respiratory Sounds	Associate	32208383
Respiratory Syncytial Virus Infections	Associate	15107295
Respiratory Tract Infections	Associate	38593276
Retinal Diseases	Associate	35259050
Retinal Dysplasia	Associate	15920558
Retinal Dysplasia	Stimulate	17559672
Retinal Neovascularization	Associate	37550343
Retinitis Pigmentosa	Associate	35410372
Retinoblastoma	Associate	17604597, 23109819, 27488116, 29615601, 29790698, 30291212, 30536303, 31483776, 32323827, 32904674, 33204686, 33896816, 34036380, 34470581, 34804455, 36284668 View all (1 more)
Retrograde Degeneration	Associate	32119650
Retroperitoneal liposarcoma	Associate	39769278
Rhabdoid Tumor	Associate	18641990
Rhabdoid Tumor Predisposition Syndrome 1	Associate	17506723, 20925002, 37726478
Rhabdomyoma	Associate	26247533
Rhabdomyosarcoma	Associate	26412593, 26445453
Rhabdomyosarcoma 1	Inhibit	34067464
Rhabdomyosarcoma Alveolar	Associate	27413008, 34203273
Rhinitis Allergic	Associate	34477124
Ring Chromosome 20 Syndrome	Associate	27534371
Ring Chromosome 20 Syndrome	Inhibit	36254861
Rufous oculocutaneous albinism	Associate	32750756
Sarcoma	Associate	21208094, 22107784, 26402468, 27219337, 33266502, 33762319, 35527027
Sarcoma Ewing	Associate	17409416, 22022506, 23681745, 23922674, 24517182, 26571493, 29036465, 40628996
Sarcoma Kaposi	Associate	11994280, 15800227, 22067664, 25234715, 30170375
Sarcoma Synovial	Associate	21809991, 23861137
Sarcopenia	Associate	18240972, 39519004
Schizophrenia	Associate	17825267, 18395980, 19051289, 20214684, 21788944, 33276438, 33765445, 33986383, 35062349
Scleroderma Systemic	Associate	17524560, 29720235
Sclerosis	Associate	31527710, 37844870
Scoliosis	Associate	32014856
Secretory breast carcinoma	Associate	36746884
Segmentation syndrome 1	Associate	30803705, 37471470
Seizures	Associate	26345935
Sepsis	Associate	35090526
Severe Acute Respiratory Syndrome	Associate	37657025
Sexual Dysfunction Physiological	Associate	25426553, 25562170
Sezary Syndrome	Associate	30518812
Shock Septic	Associate	37359526
Shwachman Diamond Syndrome	Associate	40021961
Sick Sinus Syndrome	Associate	25009009
Simpson Golabi Behmel syndrome	Associate	24782230, 25915946, 25972378, 28502725, 28525374, 29549527, 30099506, 30231930, 31490637, 31639285, 31692258, 32014856, 32500425, 32620236, 33639990 View all (5 more)
Sinonasal undifferentiated carcinoma	Associate	23633104, 28493366, 36946265
Sjogren's Syndrome	Associate	19404300, 34948236, 39819714
Skin Diseases	Associate	34074347, 34075774, 34105192
Skin Neoplasms	Associate	22805371
Skull Base Neoplasms	Associate	28482067, 33087175
Small Cell Lung Carcinoma	Associate	20346214, 20683448, 24722482, 25122428, 25695729, 27125283, 27765907, 28280736, 30832755, 31781628, 32901891, 34038205, 36717865, 36927233, 39232038
Smoke Inhalation Injury	Stimulate	24030221
Smoke Inhalation Injury	Associate	28816646
Smooth Muscle Tumor	Associate	26045786
Soft Tissue Injuries	Associate	21837670
Soft Tissue Neoplasms	Associate	19648884
Solitary Fibrous Tumors	Associate	24353015
Somatoform Disorders	Associate	22500628
Spondylitis Ankylosing	Associate	32360069, 35275449
Spondylocarpotarsal synostosis	Associate	35832491
Squamous Cell Carcinoma of Head and Neck	Associate	16245318, 16254112, 17052259, 17465209, 17785546, 18349842, 18538015, 19318490, 20513033, 20729916, 20819078, 21071608, 22505597, 22739068, 22865653 View all (90 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	19243631
Squamous Intraepithelial Lesions	Associate	16740689
Stomach Neoplasms	Associate	14562414, 14605879, 14662022, 17659701, 18782353, 18849546, 19143835, 19199544, 19925030, 19938192, 20032392, 20704765, 20848249, 20954287, 21075859 View all (232 more)
Stomach Neoplasms	Stimulate	37953442
Striae Distensae	Associate	28784087
Stroke	Associate	35557984
Subarachnoid Hemorrhage	Associate	36402441
Substance Related Disorders	Associate	35764309
Sweet Syndrome	Associate	36355435
Syndrome	Associate	21266360, 29675019, 31232238
Synovial Cyst	Associate	20187936
Synovitis Pigmented Villonodular	Associate	32929367
Systemic Inflammatory Response Syndrome	Associate	38166916
T cell lymphoma 1A	Associate	19668332
Takotsubo Cardiomyopathy	Associate	19633102
Tang Hsi Ryu syndrome	Associate	25847489
Tarlov Cysts	Associate	16721361
Telangiectasia Hereditary Hemorrhagic	Associate	35456471
Telomeric 22q13 Monosomy Syndrome	Associate	23862686
Tertiary Lymphoid Structures	Stimulate	17242701, 34531452
Tertiary Lymphoid Structures	Associate	25286393, 31781306
Thrombocythemia Essential	Associate	23243278
Thrombosis	Associate	24356513, 31490637, 34752677
Thymoma	Associate	20597130, 26766736, 30897085, 34219124, 37498332
Thymus Neoplasms	Associate	20597130
Thyroid cancer medullary	Associate	31614935
Thyroid Cancer Papillary	Associate	12733712, 14985374, 15119004, 19223551, 20564403, 20877637, 21191179, 21822208, 22549934, 25887589, 26617698, 28328831, 28634282, 29214440, 29426928 View all (23 more)
Thyroid Carcinoma Anaplastic	Associate	18831514, 22718346, 28459364, 30242671, 30804115, 31235699, 31922212, 33015797, 35491899, 36773307
Thyroid Diseases	Associate	36982542
Thyroid Hormone Resistance Syndrome	Associate	16755107
Thyroid Neoplasms	Associate	11839571, 14985374, 15743786, 15870708, 17481480, 18831514, 19487299, 20008023, 21289267, 21898122, 22090271, 22359623, 22928011, 22962422, 23725177 View all (27 more)
Thyroid Neoplasms	Stimulate	37047426
Thyroiditis	Associate	15743786
Tongue Neoplasms	Associate	16245318, 19887755, 23103626, 25749387, 32236620, 32281236, 33174521
Trachoma	Associate	27321784
Triple Negative Breast Neoplasms	Associate	24167614, 24784001, 25009009, 25955731, 26051240, 26540293, 26857281, 27038254, 27484639, 29924958, 30227836, 30237308, 30665374, 31150511, 31388935 View all (44 more)
Trisomy	Associate	29049012
Trophoblastic Neoplasms	Associate	32056133
Tuberculosis	Associate	20141546
Tuberculosis Meningeal	Associate	28173836
Tuberculosis Multidrug Resistant	Associate	19143835, 20663232, 24454800, 25747987, 27423937, 27875938, 28388564, 29450946, 30664164, 31952518, 32203206, 32400857, 32945446, 33079995, 40332431
Tuberculosis Pulmonary	Associate	20141546, 37493735, 37522815, 38075560
Tuberous Sclerosis	Associate	12867426, 19276265, 20526286, 21767323, 27918305
Tuberous Sclerosis	Inhibit	24606538
Tuberous Sclerosis 1	Associate	25149531
Typical Teratoid Rhabdoid Tumor	Associate	20925002
Tyrosine Kinase 2 Deficiency	Stimulate	34811450
Urachal Cyst	Associate	30106101
Urethral Neoplasms	Associate	21533174, 22110663, 29312470, 32767682
Urinary Bladder Diseases	Associate	26700664
Urinary Bladder Neck Obstruction	Associate	28138557
Urinary Bladder Neoplasms	Associate	16984382, 18288642, 18825409, 19875696, 20354165, 20857258, 21113138, 21408190, 21836020, 22486221, 22895070, 23300058, 23495258, 23624844, 24069250 View all (60 more)
Urologic Neoplasms	Associate	20651405, 26397152
Uterine Cervical Dysplasia	Associate	29902261
Uterine Cervical Neoplasms	Associate	16740689, 23152800, 23819460, 25135429, 25426553, 25563418, 26156805, 26183061, 26411419, 26482612, 26701206, 26933912, 27220494, 28545028, 28682441 View all (64 more)
Uterine Cervicitis	Associate	31351582
Uterine Diseases	Associate	25144715, 34082653
Uterine Neoplasms	Associate	17044934, 32994315
Uveal melanoma	Associate	21828154, 22733540, 27928645, 28138035, 32347651, 34931134, 36596361
Varicocele	Associate	26209830, 36372090
Varicose Ulcer	Associate	32867785
Varicose Veins	Associate	24850616, 36118829
Vascular Calcification	Associate	21920521, 36930472
Vascular Diseases	Associate	25363469, 25395850, 29307883, 30195866, 34873055, 37039367, 37154169, 38195507
Vascular Malformations	Associate	34040190
Vascular Remodeling	Associate	33982767
Vascular System Injuries	Associate	26364720
Venous Insufficiency	Associate	30057669
Venous Malformations Multiple Cutaneous and Mucosal	Associate	23633549, 32867785, 38367816
Venous Thromboembolism	Associate	21737128
Venous Thrombosis	Associate	32156832, 38215128
Ventilator Induced Lung Injury	Associate	30045018
Ventricular Dysfunction Left	Associate	21098579, 37697228
Virus Diseases	Associate	27252525, 33140889
Visceral Pain	Associate	40077792
Vitamin D Dependent Rickets Type 2A	Associate	35832491
Vitiligo	Associate	24410795, 31941556, 35777015
Vitreoretinopathy Proliferative	Associate	24388052, 33760200, 36672142, 37537538
von Hippel Lindau Disease	Associate	34002003
Vulvar Neoplasms	Associate	37114627
Waldenstrom Macroglobulinemia	Associate	18334673, 25371371, 28548645
Weight Loss	Associate	30289975, 34943997
Werner Syndrome	Associate	32320127
Williams Syndrome	Associate	33564861
Wilms Tumor	Associate	31035970, 32004974, 32633351, 34723730, 35485274, 37955537, 38365477
Wolf Hirschhorn Syndrome	Stimulate	35394699
Wounds and Injuries	Associate	25849550, 26196743, 32124937, 32426819, 32684834

AKT1 (AKT serine/threonine kinase 1)