Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	186
Gene name	Angiotensin II receptor type 2
Gene symbol	AGTR2
Synonyms (NCBI Gene)	AT2ATGR2MRX88
Chromosome	X
Chromosome location	Xq23
Summary	The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus and in neonates, but scantily in adult tissues, exce

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019253	hsa-miR-148b-3p	Microarray	17612493
MIRT021590	hsa-miR-142-3p	Microarray	17612493
MIRT022332	hsa-miR-124-3p	Microarray	18668037
MIRT528494	hsa-miR-548p	PAR-CLIP	22012620
MIRT528493	hsa-miR-378j	PAR-CLIP	22012620
MIRT528492	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT528491	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT528490	hsa-miR-1299	PAR-CLIP	22012620
MIRT528489	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT528488	hsa-miR-4782-5p	PAR-CLIP	22012620
MIRT528486	hsa-miR-5706	PAR-CLIP	22012620
MIRT528494	hsa-miR-548p	PAR-CLIP	22012620
MIRT528493	hsa-miR-378j	PAR-CLIP	22012620
MIRT528492	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT528491	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT528490	hsa-miR-1299	PAR-CLIP	22012620
MIRT528489	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT528488	hsa-miR-4782-5p	PAR-CLIP	22012620
MIRT528486	hsa-miR-5706	PAR-CLIP	22012620
MIRT773159	hsa-miR-1265	CLIP-seq
MIRT773160	hsa-miR-1912	CLIP-seq
MIRT773161	hsa-miR-3117-3p	CLIP-seq
MIRT773162	hsa-miR-3169	CLIP-seq
MIRT773163	hsa-miR-3180-5p	CLIP-seq
MIRT773164	hsa-miR-3609	CLIP-seq
MIRT773165	hsa-miR-4261	CLIP-seq
MIRT773166	hsa-miR-4446-3p	CLIP-seq
MIRT773167	hsa-miR-4492	CLIP-seq
MIRT773168	hsa-miR-4496	CLIP-seq
MIRT773169	hsa-miR-4498	CLIP-seq
MIRT773170	hsa-miR-4759	CLIP-seq
MIRT773171	hsa-miR-4764-5p	CLIP-seq
MIRT773172	hsa-miR-4789-5p	CLIP-seq
MIRT773173	hsa-miR-4795-3p	CLIP-seq
MIRT773174	hsa-miR-4796-3p	CLIP-seq
MIRT773175	hsa-miR-490-3p	CLIP-seq
MIRT773176	hsa-miR-520a-5p	CLIP-seq
MIRT773177	hsa-miR-525-5p	CLIP-seq
MIRT773178	hsa-miR-548ah	CLIP-seq
MIRT773179	hsa-miR-548t	CLIP-seq
MIRT773180	hsa-miR-649	CLIP-seq
MIRT773181	hsa-miR-651	CLIP-seq
MIRT773182	hsa-miR-762	CLIP-seq
MIRT773160	hsa-miR-1912	CLIP-seq
MIRT1928229	hsa-miR-3074-3p	CLIP-seq

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001974	Process	Blood vessel remodeling	TAS	17159080
GO:0001991	Process	Regulation of systemic arterial blood pressure by circulatory renin-angiotensin	IEA
GO:0001991	Process	Regulation of systemic arterial blood pressure by circulatory renin-angiotensin	ISS
GO:0002033	Process	Angiotensin-mediated vasodilation involved in regulation of systemic arterial blood pressure	IEA
GO:0002035	Process	Brain renin-angiotensin system	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004945	Function	Angiotensin type II receptor activity	IBA
GO:0004945	Function	Angiotensin type II receptor activity	IDA	28379944, 29967536, 31899086, 32669569
GO:0004945	Function	Angiotensin type II receptor activity	IEA
GO:0004945	Function	Angiotensin type II receptor activity	IPI	10406457
GO:0004945	Function	Angiotensin type II receptor activity	TAS	8502225
GO:0005515	Function	Protein binding	IPI	10406457, 18344519, 23597562
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	10406457
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7945336
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10406457
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	7945336
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	10406457
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007199	Process	G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger	IEA
GO:0007199	Process	G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger	ISS	17000928
GO:0007420	Process	Brain development	NAS	12089445
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	TAS	7477266
GO:0010459	Process	Negative regulation of heart rate	IEA
GO:0010459	Process	Negative regulation of heart rate	ISS
GO:0016020	Component	Membrane	IEA
GO:0030308	Process	Negative regulation of cell growth	TAS	17159080
GO:0035566	Process	Regulation of metanephros size	IEA
GO:0035640	Process	Exploration behavior	IEA
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	IEA
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	ISS	17000928
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	TAS	17159080
GO:0038166	Process	Angiotensin-activated signaling pathway	IEA
GO:0042311	Process	Vasodilation	IDA	15117835, 17159079
GO:0042311	Process	Vasodilation	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	NAS	15710780
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0048019	Function	Receptor antagonist activity	TAS	17159079
GO:0051387	Process	Negative regulation of neurotrophin TRK receptor signaling pathway	IMP	10406457
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0072300	Process	Positive regulation of metanephric glomerulus development	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	10406457

MIM	HGNC	e!Ensembl
300034	338	ENSG00000180772

P50052

Protein name

Type-2 angiotensin II receptor (Angiotensin II type-2 receptor) (AT2 receptor)

Protein function

Receptor for angiotensin II, a vasoconstricting peptide (PubMed:28379944, PubMed:29967536, PubMed:31899086, PubMed:8185599). Signals primarily via a non-canonical G-protein- and beta-arrestin independent pathways (PubMed:28379944). Cooperates wi

PDB

5UNF , 5UNG , 5UNH , 5XJM , 6JOD , 7C6A , 7JNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	61 → 318	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine. {ECO:0000269|PubMed:12089445}.

Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS

Sequence length

363

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
AGTR2-related disorder	Likely benign; Conflicting classifications of pathogenicity; Uncertain significance; Benign	rs387906503, rs35474657, rs2520575070, rs150381803, rs5191	RCV003964797 RCV003914827 RCV003961549 RCV003923206 RCV003915056
Intellectual disability, X-linked 88	Benign; Likely benign	rs121917810	RCV000604777

Show/Hide Text Mining Associations (45)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	37991139
Alzheimer Disease	Associate	37813091
Arthritis Rheumatoid	Associate	29038523
Atrial Fibrillation	Associate	16043935, 32383373
Cardiomegaly	Associate	12453540
Cardiomyopathy Dilated	Associate	35618744
Cardiomyopathy Hypertrophic	Associate	21163866
Cardiovascular Diseases	Associate	12453540, 28792482
Coronary Restenosis	Associate	34065198
Coronary Restenosis	Stimulate	34065198
COVID 19	Associate	35885894
Death Sudden Cardiac	Associate	19716087
Dementia	Associate	37813091
Diabetes Mellitus Type 2	Stimulate	20592051
Diabetes Mellitus Type 2	Associate	20592051, 36360309
Diabetic Nephropathies	Associate	32370637
Essential Hypertension	Associate	14627490, 31337952
Fibrosis	Associate	24473559
Fibrosis	Stimulate	9815151
Glomerulonephritis IGA	Associate	19194560
Heart Diseases	Associate	40428340
Hypertension	Associate	11153734, 12453540, 12924622, 14627490, 19274051, 22869520, 25143330, 38573093
Hypertrophy	Associate	21163866
Hypertrophy Left Ventricular	Associate	12453540, 21163866, 38573093, 40428340
Inflammation	Associate	29038523
Intellectual Disability	Associate	23871722
Ischemia	Associate	12453540
Leukoencephalopathies	Associate	19274051
Myocardial Infarction	Associate	12453540
Neoplasms	Associate	34898568
Personality Disorders	Inhibit	29038523
Polypoidal Choroidal Vasculopathy	Stimulate	30285310
Pre Eclampsia	Associate	19308748, 34796008
Prostatic Neoplasms	Associate	24658029
Pulmonary Arterial Hypertension	Associate	11153734, 34796008
Pulmonary Disease Chronic Obstructive	Associate	34051791
Schizophrenia	Associate	37511534
Scleroderma Systemic	Associate	24473559
Sick Sinus Syndrome 1 Autosomal Recessive	Associate	16043935
Stiff Skin Syndrome	Associate	27339867
Stomach Neoplasms	Associate	18059164
Synovitis	Associate	29038523
Urinary Bladder Neoplasms	Associate	34898568
Vascular System Injuries	Associate	12453540
Ventricular Dysfunction Left	Associate	40428340

AGTR2 (angiotensin II receptor type 2)