AGT (angiotensinogen)

Gene

• Entrez ID: 183
• Gene name: Angiotensinogen
• Gene symbol: AGT
• Synonyms (NCBI Gene): ANHU, SERPINA8, hFLT1
• Chromosome: 1
• Chromosome location: 1q42.2
• Summary: The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin co

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs699	A>G	Benign, risk-factor	Coding sequence variant, missense variant
rs74315283	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs121912702	G>A	Pathogenic	Stop gained, coding sequence variant
rs387906578	A>-,AA	Pathogenic	Coding sequence variant, frameshift variant, stop gained
rs747815674	C>A	Pathogenic	Splice donor variant
rs778806374	G>A	Pathogenic	Coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028917	hsa-miR-26b-5p	Microarray	19088304
MIRT2168949	hsa-miR-3613-3p	CLIP-seq
MIRT2168950	hsa-miR-4457	CLIP-seq
MIRT2168951	hsa-miR-513b	CLIP-seq
MIRT2168952	hsa-miR-548c-3p	CLIP-seq
MIRT2464834	hsa-miR-337-5p	CLIP-seq
MIRT2464835	hsa-miR-3684	CLIP-seq
MIRT2464836	hsa-miR-4428	CLIP-seq
MIRT2471486	hsa-miR-1202	CLIP-seq
MIRT2471487	hsa-miR-1245b-5p	CLIP-seq
MIRT2471488	hsa-miR-125a-3p	CLIP-seq
MIRT2471489	hsa-miR-1291	CLIP-seq
MIRT2471490	hsa-miR-181a	CLIP-seq
MIRT2471491	hsa-miR-181b	CLIP-seq
MIRT2471492	hsa-miR-181c	CLIP-seq
MIRT2471493	hsa-miR-181d	CLIP-seq
MIRT2471494	hsa-miR-2116	CLIP-seq
MIRT2471495	hsa-miR-2117	CLIP-seq
MIRT2471496	hsa-miR-2355-3p	CLIP-seq
MIRT2471497	hsa-miR-2467-3p	CLIP-seq
MIRT2471498	hsa-miR-3117-5p	CLIP-seq
MIRT2471499	hsa-miR-3121-5p	CLIP-seq
MIRT2471500	hsa-miR-3142	CLIP-seq
MIRT2471501	hsa-miR-3152-5p	CLIP-seq
MIRT2471502	hsa-miR-3160-5p	CLIP-seq
MIRT2471503	hsa-miR-3176	CLIP-seq
MIRT2471504	hsa-miR-3180-5p	CLIP-seq
MIRT2464834	hsa-miR-337-5p	CLIP-seq
MIRT2168949	hsa-miR-3613-3p	CLIP-seq
MIRT2464835	hsa-miR-3684	CLIP-seq
MIRT2471505	hsa-miR-375	CLIP-seq
MIRT2471506	hsa-miR-3922-3p	CLIP-seq
MIRT2471507	hsa-miR-3934	CLIP-seq
MIRT2471508	hsa-miR-3972	CLIP-seq
MIRT2471509	hsa-miR-3973	CLIP-seq
MIRT2471510	hsa-miR-4262	CLIP-seq
MIRT2471511	hsa-miR-4267	CLIP-seq
MIRT2471512	hsa-miR-4269	CLIP-seq
MIRT2471513	hsa-miR-4273	CLIP-seq
MIRT2471514	hsa-miR-4314	CLIP-seq
MIRT2471515	hsa-miR-4327	CLIP-seq
MIRT2464836	hsa-miR-4428	CLIP-seq
MIRT2471516	hsa-miR-4431	CLIP-seq
MIRT2168950	hsa-miR-4457	CLIP-seq
MIRT2471517	hsa-miR-4463	CLIP-seq
MIRT2471518	hsa-miR-4645-5p	CLIP-seq
MIRT2471519	hsa-miR-4646-3p	CLIP-seq
MIRT2471520	hsa-miR-4667-5p	CLIP-seq
MIRT2471521	hsa-miR-4673	CLIP-seq
MIRT2471522	hsa-miR-4677-5p	CLIP-seq
MIRT2471523	hsa-miR-4686	CLIP-seq
MIRT2471524	hsa-miR-4688	CLIP-seq
MIRT2471525	hsa-miR-4700-5p	CLIP-seq
MIRT2471526	hsa-miR-4731-3p	CLIP-seq
MIRT2471527	hsa-miR-4753-5p	CLIP-seq
MIRT2471528	hsa-miR-4755-3p	CLIP-seq
MIRT2471529	hsa-miR-4774-3p	CLIP-seq
MIRT2471530	hsa-miR-4775	CLIP-seq
MIRT2471531	hsa-miR-4801	CLIP-seq
MIRT2471532	hsa-miR-486-3p	CLIP-seq
MIRT2471533	hsa-miR-513c	CLIP-seq
MIRT2471534	hsa-miR-514b-5p	CLIP-seq
MIRT2471535	hsa-miR-520g	CLIP-seq
MIRT2471536	hsa-miR-520h	CLIP-seq
MIRT2471537	hsa-miR-539	CLIP-seq
MIRT2471538	hsa-miR-548aa	CLIP-seq
MIRT2168952	hsa-miR-548c-3p	CLIP-seq
MIRT2471539	hsa-miR-584	CLIP-seq
MIRT2471540	hsa-miR-590-3p	CLIP-seq
MIRT2471541	hsa-miR-600	CLIP-seq
MIRT2471542	hsa-miR-602	CLIP-seq
MIRT2471543	hsa-miR-636	CLIP-seq
MIRT2471544	hsa-miR-637	CLIP-seq
MIRT2471545	hsa-miR-642b	CLIP-seq
MIRT2471546	hsa-miR-764	CLIP-seq
MIRT2471547	hsa-miR-892a	CLIP-seq
MIRT2471486	hsa-miR-1202	CLIP-seq
MIRT2471487	hsa-miR-1245b-5p	CLIP-seq
MIRT2471490	hsa-miR-181a	CLIP-seq
MIRT2471491	hsa-miR-181b	CLIP-seq
MIRT2471492	hsa-miR-181c	CLIP-seq
MIRT2471493	hsa-miR-181d	CLIP-seq
MIRT2471494	hsa-miR-2116	CLIP-seq
MIRT2471496	hsa-miR-2355-3p	CLIP-seq
MIRT2471497	hsa-miR-2467-3p	CLIP-seq
MIRT2471498	hsa-miR-3117-5p	CLIP-seq
MIRT2471499	hsa-miR-3121-5p	CLIP-seq
MIRT2471500	hsa-miR-3142	CLIP-seq
MIRT2471501	hsa-miR-3152-5p	CLIP-seq
MIRT2471502	hsa-miR-3160-5p	CLIP-seq
MIRT2471503	hsa-miR-3176	CLIP-seq
MIRT2471504	hsa-miR-3180-5p	CLIP-seq
MIRT2464834	hsa-miR-337-5p	CLIP-seq
MIRT2464835	hsa-miR-3684	CLIP-seq
MIRT2471506	hsa-miR-3922-3p	CLIP-seq
MIRT2471508	hsa-miR-3972	CLIP-seq
MIRT2471509	hsa-miR-3973	CLIP-seq
MIRT2471510	hsa-miR-4262	CLIP-seq
MIRT2471511	hsa-miR-4267	CLIP-seq
MIRT2464836	hsa-miR-4428	CLIP-seq
MIRT2471516	hsa-miR-4431	CLIP-seq
MIRT2471518	hsa-miR-4645-5p	CLIP-seq
MIRT2471519	hsa-miR-4646-3p	CLIP-seq
MIRT2471521	hsa-miR-4673	CLIP-seq
MIRT2471522	hsa-miR-4677-5p	CLIP-seq
MIRT2471523	hsa-miR-4686	CLIP-seq
MIRT2471524	hsa-miR-4688	CLIP-seq
MIRT2471527	hsa-miR-4753-5p	CLIP-seq
MIRT2471528	hsa-miR-4755-3p	CLIP-seq
MIRT2471529	hsa-miR-4774-3p	CLIP-seq
MIRT2471532	hsa-miR-486-3p	CLIP-seq
MIRT2471535	hsa-miR-520g	CLIP-seq
MIRT2471536	hsa-miR-520h	CLIP-seq
MIRT2471541	hsa-miR-600	CLIP-seq
MIRT2471542	hsa-miR-602	CLIP-seq
MIRT2471545	hsa-miR-642b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	10628750;8613256
RELA	Unknown	10628750;8613256
SP1	Unknown	12032593
USF1	Repression	18802024
YBX1	Activation	11829142

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	17159080
GO:0001819	Process	Positive regulation of cytokine production	IDA	17906677
GO:0001822	Process	Kidney development	IMP	16116425
GO:0001974	Process	Blood vessel remodeling	TAS	10406457
GO:0002016	Process	Regulation of blood volume by renin-angiotensin	NAS	17159080
GO:0002018	Process	Renin-angiotensin regulation of aldosterone production	NAS	17159080
GO:0002019	Process	Regulation of renal output by angiotensin	NAS	17159080
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	IDA	26420482
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	IDA	1567413
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	TAS	10406457
GO:0003014	Process	Renal system process	IDA	21183621
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	3397061
GO:0005179	Function	Hormone activity	IC	1378723
GO:0005179	Function	Hormone activity	IDA	1567413
GO:0005179	Function	Hormone activity	ISS
GO:0005515	Function	Protein binding	IPI	10969042, 11815627, 16237761, 18202720, 20927107, 23082758, 23597562, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	1378723
GO:0005615	Component	Extracellular space	IDA	4300938
GO:0005615	Component	Extracellular space	IDA	18971559
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	10406457
GO:0007199	Process	G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger	TAS	17159080
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	NAS	17159080
GO:0007267	Process	Cell-cell signaling	TAS	8513325
GO:0008083	Function	Growth factor activity	IDA	10406457
GO:0008217	Process	Regulation of blood pressure	IGI	17416596
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	15652490
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	24296617
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	18971559
GO:0014873	Process	Response to muscle activity involved in regulation of muscle adaptation	ISS
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	TAS	19193863
GO:0017080	Function	Sodium channel regulator activity	IMP	15803439, 17703433
GO:0019229	Process	Regulation of vasoconstriction	NAS	17159080
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0031702	Function	Type 1 angiotensin receptor binding	IPI	1378723
GO:0031703	Function	Type 2 angiotensin receptor binding	IPI	10406457
GO:0032930	Process	Positive regulation of superoxide anion generation	TAS	19193863
GO:0034374	Process	Low-density lipoprotein particle remodeling	NAS	17069818
GO:0035813	Process	Regulation of renal sodium excretion	NAS	17159080
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	TAS	17159080
GO:0038166	Process	Angiotensin-activated signaling pathway	IDA	1567413
GO:0038166	Process	Angiotensin-activated signaling pathway	IDA	1567413, 15652490, 18971559, 24296617
GO:0038166	Process	Angiotensin-activated signaling pathway	IMP	15153556
GO:0042127	Process	Regulation of cell population proliferation	NAS	17159080
GO:0042310	Process	Vasoconstriction	IEA
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	23453970, 35093948
GO:0043407	Process	Negative regulation of MAP kinase activity	IMP	28283184
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	15652490
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15153556, 18607644, 24296617
GO:0048018	Function	Receptor ligand activity	IDA	24296617
GO:0048146	Process	Positive regulation of fibroblast proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	17906677
GO:0050729	Process	Positive regulation of inflammatory response	TAS	17159080
GO:0051387	Process	Negative regulation of neurotrophin TRK receptor signaling pathway	IDA	10406457
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	15652490
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070294	Process	Renal sodium ion absorption	IDA	35093948
GO:0070294	Process	Renal sodium ion absorption	ISS	14608358, 17975670
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IDA	18607644
GO:0090205	Process	Positive regulation of cholesterol metabolic process	IDA	18971559
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0110063	Process	Positive regulation of angiotensin-activated signaling pathway	IDA	25313067
GO:1901201	Process	Regulation of extracellular matrix assembly	IGI	17416596
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IDA	30729664
GO:1902306	Process	Negative regulation of sodium ion transmembrane transport	TAS	19193863
GO:1902632	Process	Positive regulation of membrane hyperpolarization	IMP	15803439, 17703433
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	30729664
GO:1903598	Process	Positive regulation of gap junction assembly	IGI	17416596
GO:1903779	Process	Regulation of cardiac conduction	IGI	17416596
GO:1990776	Process	Response to angiotensin	IBA
GO:1990776	Process	Response to angiotensin	IDA	30729664
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	17906677
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	10406457

Other IDs

• MIM: 106150
• HGNC: 333
• e!Ensembl: ENSG00000135744

Protein

• UniProt ID: P01019
• Protein name: Angiotensinogen (Serpin A8) [Cleaved into: Angiotensin-1 (Angiotensin 1-10) (Angiotensin I) (Ang I); Angiotensin-2 (Angiotensin 1-8) (Angiotensin II) (Ang II); Angiotensin-3 (Angiotensin 2-8) (Angiotensin III) (Ang III) (Des-Asp[1]-angiotensin II); Angiot
• Protein function: Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. ; [Angioten
• PDB: 1N9U, 1N9V, 2JP8, 2WXW, 2X0B, 3CK0, 3WOO, 3WOR, 4AA1, 4APH, 4FYS, 5E2Q, 5M3X, 5M3Y, 5XJM, 6I3F, 6I3I, 6JOD, 6OS0, 7C6A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00079	Serpin	108 → 481	Serpin (serine protease inhibitor)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma. {ECO:0000269|PubMed:1692023}.
• Sequence:

  MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
  KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
  HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
  LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
  FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
  WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
  FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
  VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
  PLSTA

• Sequence length: 485

<

Associated diseases

Causal
Disease merge term	Disease name	dbSNP ID	References
Renal Tubular Dysgenesis Of Genetic Origin	Renal tubular dysgenesis, renal tubular dysgenesis of genetic origin	rs74315283, rs121912702, rs387906578, rs747815674	N/A

Unknown
Disease merge term	Disease name	Evidence	References	Source
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Hypertension	Essential hypertension (PheCode 401.1), High blood pressure / hypertension, Hypertension, Hypertension (confirmatory factor analysis Factor 12), Hypertension (PheCode 401)	N/A	N/A	GWAS
Microcephaly	microcephaly	N/A	N/A	ClinVar
Pancreatic adenocarcinoma	Pancreatic ductal adenocarcinoma	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Achalasia Addisonianism Alacrimia syndrome	Associate	20945963
Acute Coronary Syndrome	Associate	20549134
Acute Kidney Injury	Associate	12911556, 24009222, 31880583
Albuminuria	Associate	31611175
Alzheimer Disease	Associate	27884212, 29348391
Amyotrophic Lateral Sclerosis	Associate	27814735
Anemia Sickle Cell	Associate	11754397
Aneurysm	Associate	37731512
Aneurysm Ascending Aorta	Stimulate	26071572
Angina Stable	Associate	11451295
Angina Unstable	Stimulate	11451295
Angina Unstable	Associate	15131005, 28281389
Anterior Wall Myocardial Infarction	Associate	23283822
Anxiety	Associate	20967221
Aortic Aneurysm	Stimulate	22588264
Aortic Aneurysm Abdominal	Associate	35602104
Aortic Aneurysm Abdominal	Stimulate	37822152
Aortic Aneurysm Familial Abdominal 1	Associate	37731512
Aortic Aneurysm Thoracic	Stimulate	25767191
Aortic Dissection	Associate	31427887
Aortic Dissection	Stimulate	35866606
Apical Hypertrophic Cardiomyopathy	Stimulate	35703318
Arterial Occlusive Diseases	Associate	20663844
Arteriosclerosis	Associate	16556868
Arthritis Rheumatoid	Associate	33952303, 34458379
Asthma	Associate	22325360, 39380119
Astrocytoma	Associate	30383794, 32535722
Atherosclerosis	Associate	15569271, 16085213, 20500895, 20945963, 22796540, 23497386, 23997101, 25573199, 27696667, 28186543, 34292876, 7518396
Atherosclerosis	Stimulate	25250890
Atrial Fibrillation	Associate	21436211, 23077077, 25219839, 26240116, 30542083, 35756425
Atrial Fibrillation	Stimulate	28323847, 28871102
Atrial Remodeling	Associate	12692750, 14642689, 25219839, 30542083, 31888494
Autistic Disorder	Associate	27082637
Bipolar Disorder	Associate	18363708
Blood Coagulation Disorders	Associate	32655579
Brain Diseases	Associate	18363708
Brain Injuries	Associate	27788506
Breast Neoplasms	Associate	21109584, 25077884, 31142626, 31642813, 32663742
Brugada Syndrome	Associate	23276942
Calcinosis	Stimulate	22796540
Carcinoma Hepatocellular	Associate	33618227, 7961807
Carcinoma Renal Cell	Associate	20047954, 29215599, 32977573
Cardiomegaly	Associate	12675870, 23943853, 38296564
Cardiomegaly	Stimulate	25217633, 35406003, 35726535, 35756425, 36517015, 37488545, 37972803
Cardiomyopathies	Stimulate	35703318
Cardiomyopathies	Associate	35756425
Cardiomyopathy Dilated	Associate	20945963
Cardiomyopathy Dilated	Stimulate	37822152
Cardiomyopathy Hypertrophic	Stimulate	21047517, 32533462, 35334035, 37445727
Cardiomyopathy Hypertrophic	Associate	21163864
Cardiovascular Diseases	Associate	11345362, 12938141, 15237001, 15718497, 18403595, 18855268, 18985387, 21449976, 28261909, 28605058, 30719178, 30875817, 31373631, 34292876
Cardiovascular Diseases	Stimulate	26240115
Carotid Artery Diseases	Associate	17298481, 9678776
Carotid Artery Diseases	Stimulate	27782101
Carotid Stenosis	Associate	32871819
Celiac Disease	Associate	27483138
Cerebral Arterial Diseases	Associate	23943853
Cerebral Infarction	Associate	17952138
Cerebrovascular Disorders	Associate	17220293
Cerebrovascular Disorders	Stimulate	27782101
Cholangiocarcinoma	Associate	22664794
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	26092580
Chronic Kidney Disease Mineral and Bone Disorder	Associate	28186543
Cognitive Dysfunction	Associate	10916074, 19274077
Colorectal Neoplasms	Associate	18181094, 23036011, 25428203, 34285715, 34473751
Constriction Pathologic	Associate	20663844
Corneal Endothelial Cell Loss	Inhibit	32027625
Corneal Endothelial Cell Loss	Stimulate	33357779
Coronary Aneurysm	Associate	30719178
Coronary Artery Disease	Associate	20663844, 23497386, 23943853, 24722536, 27432541, 30912862, 34275374, 36360218, 36421822
Coronary Disease	Associate	11345362, 19327134, 22388798, 9034401
Coronary Disease	Stimulate	16088850
Coronary Restenosis	Associate	11849656, 12205735, 28196432, 32093874, 34065198, 36360218
Coronary Stenosis	Associate	20663844, 27432541
COVID 19	Associate	32655579, 32663742, 32901433, 33458761, 34194422, 34774774, 34935423, 35165525, 35458690, 35548940, 35563515, 35661534, 35841981, 36443248, 39630802
COVID 19	Stimulate	32664949, 34144455, 34895256, 35793758
Critical Illness	Associate	32655579
Crohn Disease	Associate	17047091
Crohn Disease	Inhibit	27014752
Cushing Syndrome	Associate	30480750
Cyclic neutropenia	Associate	23132846
Cysts	Associate	23907112, 26092580
Cytokine Release Syndrome	Stimulate	26240115
Death	Associate	24009222, 24722536, 36421822
Diabetes Complications	Associate	16520412
Diabetes Gestational	Associate	39397405
Diabetes Mellitus	Associate	11422735, 12205735, 16520412, 16556868, 19421330, 20717043, 20814220, 23594830, 24549414, 24737640, 34292876, 34669152, 37693342
Diabetes Mellitus	Stimulate	24284398
Diabetes Mellitus Type 1	Associate	18413222, 23657857
Diabetes Mellitus Type 2	Associate	19243623, 19327134, 20592051, 23358739, 23497386, 26682227, 27483138, 27782101, 28488548, 33668947, 8840299
Diabetic Nephropathies	Associate	11961304, 17487826, 17653210, 19034303, 19864304, 20606419, 21421655, 21500980, 24284398, 24737640, 26412030, 28488548, 32370637, 33668947
Diabetic Nephropathies	Stimulate	12969130, 20712135
Diabetic Retinopathy	Associate	8814748
Diastrophic dysplasia	Stimulate	17487825, 23199721
Disease	Associate	21109584, 23715995
Disease Progression	Stimulate	20478903
Drug Related Side Effects and Adverse Reactions	Inhibit	17900533
Drug Related Side Effects and Adverse Reactions	Associate	32655579
Drug Related Side Effects and Adverse Reactions	Stimulate	34789642
Dyslipidemias	Associate	32356512, 40717713
Endometrial Neoplasms	Associate	15741767
Endometriosis	Associate	29303211
Essential Hypertension	Associate	10652033, 11325075, 11345362, 12145290, 12169209, 12417054, 12611423, 12661912, 15077204, 15811183, 17190732, 17448297, 17475670, 17546276, 17952138, 18404605, 18855268, 19243623, 19770777, 20216084, 20662730, 21629041, 22148914, 22371359, 22570327, 22799745, 22974788, 23943853, 24015270, 24452034, 24490766, 24860821, 25143324, 25366732, 2554039, 26283679, 26305278, 26391364, 27398822, 30542083, 31337952, 32338289, 32555714, 34758666, 39512695, 7635961, 7649545, 7744780, 8132767, 8177268, 9120024, 9199566, 9421481, 9607178
Essential Hypertension	Stimulate	33275245
Essential Tremor	Associate	9199566
Failed Back Surgery Syndrome	Stimulate	15821752
Fetal Growth Retardation	Associate	25271252
Fetofetal Transfusion	Associate	10666392
Fibrosis	Associate	10432384, 15049387, 15519020, 18206321, 19220742, 20478903, 20814220, 22664794, 23715995, 32664949, 32901433
Fibrosis	Stimulate	16556868, 19648063, 23324179, 24798563, 31611175, 32777324, 32977573, 34663163, 35348192, 37488545
Frailty	Associate	39464190
Glaucoma Related Pigment Dispersion Syndrome	Associate	18364271
Glioblastoma	Associate	32133779
Glomerulonephritis	Associate	10432384, 11422735
Glomerulonephritis	Stimulate	18421480
Glomerulonephritis IGA	Associate	12164881, 12911556, 15458433, 21670416, 25523477, 38154557
Glomerulonephritis IGA	Stimulate	18421480, 20615910
Glomerulonephritis Membranous	Associate	12969126, 30414341
Glycosuria Renal	Associate	20615910, 31880583
Graves Ophthalmopathy	Associate	38130930
HAIR AN syndrome	Stimulate	38269483
Heart Arrest	Associate	33336526
Heart Diseases	Associate	20549134
Heart Diseases	Stimulate	26452457, 27696667, 32655579
Heart Failure	Associate	12453539, 15569271, 18279468, 20549134, 20945963, 22939879, 32638886, 33926172, 35886041, 7682566
Heart Failure	Stimulate	35886041
Heart Failure Systolic	Associate	31560448
Heart Valve Diseases	Associate	21436211
Hematologic Neoplasms	Associate	23132846
Hemochromatosis	Associate	27910864
Histiocytosis Langerhans Cell	Associate	10975922
Hodgkin Disease	Associate	32235718
Hyperaldosteronism	Inhibit	2554039
Hyperaldosteronism	Associate	33796077
Hyperglycemia	Stimulate	19225232
Hyperplasia	Associate	16272779
Hypertension	Associate	10412879, 10487325, 10586529, 11153734, 11325075, 11409653, 11675943, 12145290, 12164881, 12169209, 12661912, 12675870, 12911556, 12938141, 12939534, 12950120, 15049387, 15077204, 15492926, 15569271, 15811183, 16369102, 16532385, 16556868, 16876684, 17334527, 18248681, 18403595, 18404605, 18562701, 18647135, 18698212, 18758497, 18923060, 19220742, 19421330, 19770777, 20047954, 20216084, 20223792, 20549134, 20592457, 20717043, 20927107, 21248783, 21594893, 21628354, 21629041, 21670416, 21845073, 22012329, 22148914, 22419662, 22791701, 23036011, 23497386, 23529640, 23648704, 23907112, 23943853, 24015270, 24452034, 24722130, 24860821, 25143324, 25262176, 25961019, 28105631, 28467442, 29040610, 30875817, 31345003, 31373631, 31524252, 31781716, 32475043, 32871819, 33668947, 33792450, 33885378, 33973418, 34758666, 35548940, 37154169, 37445727, 37693342, 38573093, 40352208, 40717713, 7518396, 7635961, 7744780, 7883995, 8621667, 9034402, 9199566, 9728481
Hypertension	Inhibit	11964369
Hypertension	Stimulate	26092580, 26945075, 31237175
Hypertension Pregnancy Induced	Associate	10586529
Hypertension Pregnancy Induced	Stimulate	31237175
Hypertrophy	Associate	15049387, 19074594, 24823657, 36952519
Hypertrophy	Stimulate	32533462, 34854353, 35334035, 35703318, 35756425, 36517015, 38296564, 7929089
Hypertrophy Left Ventricular	Associate	10440164, 12675870, 15049387, 9822439
Hyperuricemia	Associate	23529640
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	33807151, 9120002
Hypotension	Associate	18773126
Hypotrichosis	Associate	32293282
Hypoxia	Stimulate	25573199
Hypoxia	Associate	29215599, 30560688
Hypoxia Ischemia Brain	Associate	30915766
Idiopathic Pulmonary Fibrosis	Associate	16844946, 18508830, 23715995
IgA Vasculitis	Associate	20702504
Immune System Diseases	Associate	32655579
Infarction	Associate	23283822
Inflammation	Associate	12969130, 15131005, 17666408, 18314486, 20478903, 20500895, 22796540, 23122314, 23392788, 24486907, 25250890, 27014752, 31038541, 31880583, 32758871, 32901433, 33357779, 34144455, 35607951, 36359814
Inflammation	Stimulate	15519020, 18363708, 28578904, 28871102, 37445727, 37731512
Inflammatory Bowel Diseases	Associate	20717043, 35232999
Inflammatory Breast Neoplasms	Associate	20830311
Insulin Resistance	Associate	18052686, 21306748, 23036011, 24722130
Intervertebral Disc Degeneration	Associate	36123994
Iron Overload	Associate	33969695
Ischemia	Associate	11451295
Kidney Diseases	Associate	11961304, 12164881, 12950120, 16598193, 18206321, 19225232, 19327134, 20615910, 20702504, 21421655, 21670416, 24241364, 24284398, 24737640, 25271252, 26092580, 28807596, 31237175, 31611175, 33785019, 34448643
Kidney Diseases	Stimulate	18421480, 26943326
Kidney Failure Chronic	Associate	10916074, 11422735, 11918733, 12675870, 12950120, 16105049, 24977181, 33668947, 9259580
Kidney Failure Chronic	Inhibit	26412030
Kidney Tubular Necrosis Acute	Stimulate	27788506
Leukemia Lymphocytic Chronic B Cell	Stimulate	19761684
Limbal Stem Cell Deficiency	Associate	30332462
Liver Cirrhosis	Associate	28798388
Liver Cirrhosis	Stimulate	33223956
Long QT Syndrome	Associate	18364271
Lung Injury	Associate	12754187, 16691016, 36584778
Lung Neoplasms	Associate	16612594
Lymphangioleiomyomatosis	Associate	16474096
Lymphatic Metastasis	Associate	18059164
Malnutrition	Associate	23036011
Mannose Binding Protein Deficiency	Inhibit	35867861
Marfan Syndrome	Associate	31936351
Mental Disorders	Stimulate	26092580
Mesenteric Vascular Occlusion	Associate	17666408
Metabolic Syndrome	Associate	32356512
Mitochondrial Diseases	Stimulate	26943326
Mitral Valve Insufficiency	Associate	30581499
Mouth Neoplasms	Associate	29937423, 35421271
Mucocutaneous Lymph Node Syndrome	Associate	28262744, 30719178
Multiple Sclerosis	Associate	28127518
Muscular Diseases	Associate	37862321
Myocardial Infarction	Associate	20663844, 23283822, 23497386, 24806378, 27329205, 31147455, 9034401
Myocardial Ischemia	Associate	19706169, 20945963, 40717713
Myocardial Stunning	Associate	30983140
Neoplasm Metastasis	Associate	24485798, 36431925
Neoplasms	Associate	15741767, 16612594, 18181094, 18630525, 19190164, 21479216, 22664794, 2554039, 25682288, 26954714, 31042345, 31142626, 31642813, 33513805, 36431925
Neoplasms	Stimulate	16434990
Nephritis	Associate	24463829
Nephritis Interstitial	Associate	10916074, 12969126
Nephrosis Lipoid	Associate	20478903, 23681285
Nephrotic Syndrome	Associate	33785019
Neuroblastoma	Inhibit	22253825
Neurodegenerative Diseases	Associate	25645462
Non alcoholic Fatty Liver Disease	Associate	34275374
Obesity	Stimulate	10933310
Obesity	Associate	15044674, 15231849, 20216084, 22648117, 22880127, 23497386, 32356512, 34292876, 39464190
Organizing Pneumonia	Associate	10487325, 10652033, 32901433
Osteoarthritis	Associate	27866912
Osteoarthritis Knee	Associate	34073132
Osteolysis	Associate	10975922
Osteoporosis	Associate	21845073
Ovarian Neoplasms	Associate	16434990, 38527595
Overweight	Associate	15055256, 20047954, 32356512
Pain	Associate	35033099
Pancreatic Neoplasms	Associate	11334891
Pancreatitis	Associate	24743610
Parkinson Disease	Associate	17900533, 25645462
Paroxysmal ventricular fibrillation	Associate	27759448
Periodontitis	Associate	22092770
Peripheral Arterial Disease	Associate	19782519
Philadelphia Chromosome	Associate	36557898
Plaque Atherosclerotic	Associate	26947595, 33231566
Polycystic Kidney Autosomal Dominant	Associate	12950120, 26092580
Polycystic Ovary Syndrome	Associate	34480296
Polycythemia	Associate	9410909
Post Acute COVID 19 Syndrome	Associate	36517875, 37924708
Pre Eclampsia	Associate	12417054, 12911547, 15492926, 17520398, 18562701, 20537141, 20927107, 21436209, 22570525, 23246097, 26010865, 27064514, 36088594, 7744780
Pre Eclampsia	Inhibit	17851801
Pre Eclampsia	Stimulate	26574162, 31237175
Preeclamptic toxemia	Associate	33459093
Pregnancy in Diabetics	Associate	9199566
Prehypertension	Associate	24722130
Pressure Ulcer	Associate	25143324
Primary hyperoxaluria type 1	Associate	20564000, 30541997, 36557898, 8245128, 9192270
Prostatic Neoplasms	Associate	18314486
Prostatitis	Associate	18314486
Proteinuria	Associate	12969130, 17622313, 9259580
Psoriasis	Associate	33416099
Pterygium	Associate	25308851
Pulmonary Arterial Hypertension	Associate	36289015, 38573093
Pulmonary edema of mountaineers	Associate	21393362, 22156739
Renal Insufficiency	Associate	22012329, 33960101, 37711897
Renal Insufficiency Chronic	Associate	16672053, 17622313, 22147663, 29984779, 31880583, 32999213
Renal Insufficiency Chronic	Stimulate	25782922
Retinal Diseases	Associate	35133402
Retinal Vein Occlusion	Associate	31173043
Retinitis	Associate	10652033
Retinoblastoma	Stimulate	30536303
Rhinitis Allergic	Associate	25594855
Schizophrenia	Associate	18363708, 28605058
Sexual Dysfunction Physiological	Associate	33785019
Shock	Associate	16691016, 16775386
Sick Sinus Syndrome	Associate	22242192
Sick Sinus Syndrome 1 Autosomal Recessive	Associate	22242192
Sjogren's Syndrome	Associate	38128705
Sleep Apnea Obstructive	Stimulate	16085213
Sleep Apnea Syndromes	Associate	16085213
Squamous Cell Carcinoma of Head and Neck	Associate	18630525, 29240723, 33513805
ST Elevation Myocardial Infarction	Associate	31873176
Stomach Neoplasms	Associate	18059164, 22563200, 33495829
Stroke	Associate	11754397, 18363708
Systemic Inflammatory Response Syndrome	Stimulate	34144455
Takotsubo Cardiomyopathy	Associate	39513871
Thoracic Outlet Syndrome	Stimulate	36835372
Thromboembolism	Associate	20717043
Thrombophilia	Associate	20592457, 20717043
Thrombosis	Associate	32758871, 36845669
Tobacco Use Disorder	Associate	28127518
Tooth Resorption	Stimulate	21845073
Tuberculosis Pulmonary	Associate	38380450
Umbilical cord ulceration and intestinal atresia	Associate	30915766
Uremia	Associate	28186543
Urinary Bladder Neoplasms	Associate	19190164, 34898568, 37455529
Uterine Cervical Neoplasms	Inhibit	23231583
Vascular Calcification	Stimulate	22796540
Vascular Diseases	Associate	14644777, 15005273, 16520412, 19462315, 23943853, 26101159, 26452457, 37154169
Vascular Diseases	Stimulate	24486907
Vascular Remodeling	Associate	31373631
Vascular Remodeling	Stimulate	33647858
Vascular System Injuries	Associate	16272779
Vascular System Injuries	Stimulate	32027625
Ventricular Dysfunction Left	Associate	10440164, 20549134
Ventricular Fibrillation	Associate	21248783
Ventricular Remodeling	Associate	23283822
Virus Diseases	Associate	35165525
Williams Syndrome	Associate	16532385
Wounds and Injuries	Stimulate	33439236, 34789642, 36840500
Wounds and Injuries	Associate	34448643