Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	181
Gene name Gene Name - the full gene name approved by the HGNC.	Agouti related neuropeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AGRP
Synonyms (NCBI Gene) Gene synonyms aliases	AGRT, ART, ASIP2
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostas

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018298	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10318826
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	15927146
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	9311920
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15927146
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IDA	15927146
GO:0005796	Component	Golgi lumen	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15927146
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	9311920
GO:0007623	Process	Circadian rhythm	IEA
GO:0007631	Process	Feeding behavior	TAS	9751529
GO:0008343	Process	Adult feeding behavior	IBA
GO:0008343	Process	Adult feeding behavior	IEA
GO:0008343	Process	Adult feeding behavior	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0048571	Process	Long-day photoperiodism	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060259	Process	Regulation of feeding behavior	IDA	15927146
GO:0060259	Process	Regulation of feeding behavior	IMP	9311920
GO:0070996	Function	Type 1 melanocortin receptor binding	IBA
GO:2000253	Process	Positive regulation of feeding behavior	IBA
GO:2000253	Process	Positive regulation of feeding behavior	IEA

MIM	HGNC	e!Ensembl
602311	330	ENSG00000159723

Protein

UniProt ID

O00253

Protein name

Agouti-related protein

Protein function

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocorti

PDB

1HYK , 1MR0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05039	Agouti	34 → 122	Agouti protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.

Sequence

MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
KLGTAMNPCSRT

Sequence length

132

Interactions

View interactions

AGRP (agouti related neuropeptide)