ADRA1B (adrenoceptor alpha 1B)

Gene

• Entrez ID: 147
• Gene name: Adrenoceptor alpha 1B
• Gene symbol: ADRA1B
• Synonyms (NCBI Gene): ADRA1, ALPHA1BAR
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047408	hsa-miR-10b-5p	CLASH	23622248
MIRT769805	hsa-miR-224	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	22723743, 24567387, 25775528, 28862946, 29426850
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005901	Component	Caveola	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007267	Process	Cell-cell signaling	IBA	21873635
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0035556	Process	Intracellular signal transduction	TAS	10820200
GO:0043410	Process	Positive regulation of MAPK cascade	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0045907	Process	Positive regulation of vasoconstriction	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0150099	Process	Neuron-glial cell signaling	ISS

Other IDs

• MIM: 104220
• HGNC: 278
• e!Ensembl: ENSG00000170214

Protein

• UniProt ID: P35368
• Protein name: Alpha-1B adrenergic receptor (Alpha-1B adrenoreceptor) (Alpha-1B adrenoceptor)
• Protein function: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	62 → 348	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
  VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
  WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
  LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
  VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
  GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
  RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
  LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
  EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

• Sequence length: 520