Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	148
Gene name	Adrenoceptor alpha 1A
Gene symbol	ADRA1A
Synonyms (NCBI Gene)	ADRA1CADRA1L1ALPHA1AAR
Chromosome	8
Chromosome location	8p21.2
Summary	Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

Show/Hide all (98)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041983	hsa-miR-484	CLASH	23622248
MIRT769775	hsa-miR-105	CLIP-seq
MIRT769776	hsa-miR-199a-3p	CLIP-seq
MIRT769777	hsa-miR-199b-3p	CLIP-seq
MIRT769778	hsa-miR-223	CLIP-seq
MIRT769779	hsa-miR-3129-5p	CLIP-seq
MIRT769780	hsa-miR-323b-5p	CLIP-seq
MIRT769781	hsa-miR-3545-3p	CLIP-seq
MIRT769782	hsa-miR-4474-3p	CLIP-seq
MIRT769783	hsa-miR-4539	CLIP-seq
MIRT769784	hsa-miR-4687-3p	CLIP-seq
MIRT769785	hsa-miR-4697-3p	CLIP-seq
MIRT769786	hsa-miR-582-3p	CLIP-seq
MIRT769787	hsa-miR-936	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769789	hsa-miR-24	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769795	hsa-miR-4284	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769803	hsa-miR-564	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT1927074	hsa-miR-335	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769789	hsa-miR-24	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT1927074	hsa-miR-335	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769795	hsa-miR-4284	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT2470510	hsa-miR-2115	CLIP-seq
MIRT2470511	hsa-miR-345	CLIP-seq
MIRT2470512	hsa-miR-4267	CLIP-seq
MIRT2470513	hsa-miR-579	CLIP-seq
MIRT2470510	hsa-miR-2115	CLIP-seq
MIRT2470511	hsa-miR-345	CLIP-seq
MIRT2470512	hsa-miR-4267	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CREB1	Unknown	10520459
SP1	Unknown	10520459
TFAP2A	Unknown	10520459

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001985	Process	Negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure	IEA
GO:0001994	Process	Norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IEA
GO:0001997	Process	Positive regulation of the force of heart contraction by epinephrine-norepinephrine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	NAS	9490024
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	7737411
GO:0005515	Function	Protein binding	IPI	20508391, 24567387
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8396931
GO:0005901	Component	Caveola	IEA
GO:0006915	Process	Apoptotic process	TAS	10671514
GO:0006937	Process	Regulation of muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	8183249
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8396931
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10860850
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	TAS	8396931
GO:0007512	Process	Adult heart development	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10860850
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0009725	Process	Response to hormone	ISS
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0031965	Component	Nuclear membrane	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	ISS
GO:0035265	Process	Organ growth	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	10671514
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045760	Process	Positive regulation of action potential	ISS
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0071875	Process	Adrenergic receptor signaling pathway	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0071882	Process	Phospholipase C-activating adrenergic receptor signaling pathway	ISS
GO:0097195	Process	Pilomotor reflex	IEA
GO:0150099	Process	Neuron-glial cell signaling	IEA
GO:0150099	Process	Neuron-glial cell signaling	ISS

MIM	HGNC	e!Ensembl
104221	277	ENSG00000120907

P35348

Protein name

Alpha-1A adrenergic receptor (Alpha-1A adrenoreceptor) (Alpha-1A adrenoceptor) (Alpha-1C adrenergic receptor) (Alpha-adrenergic receptor 1c)

Protein function

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu

PDB

7YM8 , 7YMH , 7YMJ , 8HN1 , 8THK , 8THL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	43 → 326	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in

Sequence

MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV

Sequence length

466

Interactions

View interactions

ADRA1A (adrenoceptor alpha 1A)