Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	148
Gene name Gene Name - the full gene name approved by the HGNC.	Adrenoceptor alpha 1A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADRA1A
Synonyms (NCBI Gene) Gene synonyms aliases	ADRA1C, ADRA1L1, ALPHA1AAR
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

Show/Hide all(98)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041983	hsa-miR-484	CLASH	23622248
MIRT769775	hsa-miR-105	CLIP-seq
MIRT769776	hsa-miR-199a-3p	CLIP-seq
MIRT769777	hsa-miR-199b-3p	CLIP-seq
MIRT769778	hsa-miR-223	CLIP-seq
MIRT769779	hsa-miR-3129-5p	CLIP-seq
MIRT769780	hsa-miR-323b-5p	CLIP-seq
MIRT769781	hsa-miR-3545-3p	CLIP-seq
MIRT769782	hsa-miR-4474-3p	CLIP-seq
MIRT769783	hsa-miR-4539	CLIP-seq
MIRT769784	hsa-miR-4687-3p	CLIP-seq
MIRT769785	hsa-miR-4697-3p	CLIP-seq
MIRT769786	hsa-miR-582-3p	CLIP-seq
MIRT769787	hsa-miR-936	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769789	hsa-miR-24	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769795	hsa-miR-4284	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769803	hsa-miR-564	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT1927074	hsa-miR-335	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769789	hsa-miR-24	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT1927074	hsa-miR-335	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769795	hsa-miR-4284	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT769788	hsa-miR-1827	CLIP-seq
MIRT769790	hsa-miR-3122	CLIP-seq
MIRT769791	hsa-miR-3689a-3p	CLIP-seq
MIRT769792	hsa-miR-3689c	CLIP-seq
MIRT769793	hsa-miR-3913-5p	CLIP-seq
MIRT769794	hsa-miR-3929	CLIP-seq
MIRT769796	hsa-miR-4419b	CLIP-seq
MIRT769797	hsa-miR-4478	CLIP-seq
MIRT769798	hsa-miR-4514	CLIP-seq
MIRT769799	hsa-miR-4649-3p	CLIP-seq
MIRT769800	hsa-miR-4692	CLIP-seq
MIRT769801	hsa-miR-4728-5p	CLIP-seq
MIRT769802	hsa-miR-485-5p	CLIP-seq
MIRT769804	hsa-miR-940	CLIP-seq
MIRT2470510	hsa-miR-2115	CLIP-seq
MIRT2470511	hsa-miR-345	CLIP-seq
MIRT2470512	hsa-miR-4267	CLIP-seq
MIRT2470513	hsa-miR-579	CLIP-seq
MIRT2470510	hsa-miR-2115	CLIP-seq
MIRT2470511	hsa-miR-345	CLIP-seq
MIRT2470512	hsa-miR-4267	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CREB1	Unknown	10520459
SP1	Unknown	10520459
TFAP2A	Unknown	10520459

Show/Hide all(65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001985	Process	Negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure	IEA
GO:0001994	Process	Norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IBA	21873635
GO:0001997	Process	Positive regulation of the force of heart contraction by epinephrine-norepinephrine	IEA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA	21873635
GO:0004937	Function	Alpha1-adrenergic receptor activity	ISS
GO:0004937	Function	Alpha1-adrenergic receptor activity	NAS	9490024
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	7737411
GO:0005515	Function	Protein binding	IPI	24567387, 25775528, 27331810, 28862946
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005901	Component	Caveola	IEA
GO:0006915	Process	Apoptotic process	TAS	10671514
GO:0006939	Process	Smooth muscle contraction	TAS	8183249
GO:0007165	Process	Signal transduction	TAS	8396931
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007202	Process	Activation of phospholipase C activity	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007267	Process	Cell-cell signaling	IBA	21873635
GO:0007512	Process	Adult heart development	IEA
GO:0007568	Process	Aging	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10860850
GO:0009725	Process	Response to hormone	ISS
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0030018	Component	Z disc	IEA
GO:0030315	Component	T-tubule	IEA
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	ISS
GO:0035024	Process	Negative regulation of Rho protein signal transduction	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	10671514
GO:0042493	Process	Response to drug	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0045760	Process	Positive regulation of action potential	ISS
GO:0045907	Process	Positive regulation of vasoconstriction	IBA	21873635
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0060073	Process	Micturition	IEA
GO:0060402	Process	Calcium ion transport into cytosol	ISS
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0090037	Process	Positive regulation of protein kinase C signaling	ISS
GO:0097195	Process	Pilomotor reflex	IEA
GO:0098691	Component	Dopaminergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0150099	Process	Neuron-glial cell signaling	ISS
GO:1903997	Process	Positive regulation of non-membrane spanning protein tyrosine kinase activity	IEA
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

MIM	HGNC	e!Ensembl
104221	277	ENSG00000120907

Protein

UniProt ID

P35348

Protein name

Alpha-1A adrenergic receptor (Alpha-1A adrenoreceptor) (Alpha-1A adrenoceptor) (Alpha-1C adrenergic receptor) (Alpha-adrenergic receptor 1c)

Protein function

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu

PDB

7YM8 , 7YMH , 7YMJ , 8HN1 , 8THK , 8THL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	43 → 326	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in

Sequence

MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV

Sequence length

466

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Atrial Fibrillation	Atrial Fibrillation			GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	26827652
Attention Deficit Disorder with Hyperactivity	Associate	34184773
Carcinoma Hepatocellular	Inhibit	24160375
Carcinoma Hepatocellular	Associate	24607627, 31933413, 34706275
Carcinoma Renal Cell	Associate	31140607
Celiac Disease	Associate	31554915
COVID 19	Associate	33691446
Dementia	Inhibit	17324522
Endometrial Neoplasms	Associate	35832124
Fibromyalgia	Associate	19565482
general anxiety disorder	Associate	28198454
Horner Syndrome	Stimulate	36831252
Hypertension	Associate	19105822, 20044737, 36012699, 36831252
Hypertrophy	Associate	9353275
Intervertebral Disc Degeneration	Associate	36499685
Mental Disorders	Associate	34184773
Morning Sickness	Associate	19565482
Neoplasms	Associate	31933413
Neuroblastoma	Associate	9353275
Obesity	Associate	36831252
Prostatic Hyperplasia	Associate	9353275
Prostatic Neoplasms	Associate	19763272
Pulmonary Edema	Associate	33166306
Schizophrenia	Associate	34184773
Syncope Vasovagal	Associate	36140820
Uterine Cervicitis	Associate	29197114

ADRA1A (adrenoceptor alpha 1A)