Gene Gene information from NCBI Gene database.
Entrez ID 51094
Gene name Adiponectin receptor 1
Gene symbol ADIPOR1
Synonyms (NCBI Gene)
ACDCR1CGI-45CGI45PAQR1TESBP1A
Chromosome 1
Chromosome location 1q32.1
Summary This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase
miRNA miRNA information provided by mirtarbase database.
259
miRTarBase ID miRNA Experiments Reference
MIRT048047 hsa-miR-197-3p CLASH 23622248
MIRT441261 ebv-miR-BART7-3p HITS-CLIP 22473208
MIRT441261 ebv-miR-BART7-3p HITS-CLIP 22473208
MIRT768907 hsa-miR-1254 CLIP-seq
MIRT768908 hsa-miR-127-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
ATF3 Repression 20696134
FOXO1 Activation 20125105
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 29190778, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 12802337, 19233263
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607945 24040 ENSG00000159346
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96A54
Protein name Adiponectin receptor protein 1 (Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)
Protein function Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:12802337, PubMed:25855295). Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-bin
PDB 5LXG , 6KRZ , 6KS0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03006 HlyIII 129 352 Haemolysin-III related Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed (PubMed:16044242). Highly expressed in heart and skeletal muscle (PubMed:12802337). Expressed at intermediate level in brain, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes (PubMed:12802337). Wea
Sequence
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHF
YGVSNLQE
FRYGLEGGCTDDTLL
Sequence length 375
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
8
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
ADIPOR1-related disorder Likely benign rs889809506 RCV003912174
Malignant tumor of esophagus Likely benign rs201007271 RCV005912902
Retinal dystrophy Benign; Uncertain significance; Likely benign rs376585520, rs773404208, rs750288767, rs139792596, rs749789403, rs2527477123 RCV003888237
RCV004816902
RCV004817051
RCV003890399
RCV003890411
RCV003890418
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adrenal Gland Neoplasms Associate 29689708
Alzheimer Disease Associate 36527105
Autism Spectrum Disorder Associate 37478258
Barrett Esophagus Associate 23756394
Brain Ischemia Associate 38049739
Breast Neoplasms Associate 18451143, 20553615, 20697428, 23750285, 23776679, 28173833, 28327197, 29311755, 33067778, 35846306
Carcinoma Hepatocellular Associate 24619866, 35733794, 39849382
Carcinoma Non Small Cell Lung Associate 23358237, 29956809
Carcinoma Ovarian Epithelial Associate 28356549
Carcinoma Ovarian Epithelial Inhibit 29603059