Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9370
Gene name Gene Name - the full gene name approved by the HGNC.	Adiponectin, C1Q and collagen domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADIPOQ
Synonyms (NCBI Gene) Gene synonyms aliases	ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs876661321	G>T	Risk-factor	Upstream transcript variant

Show/Hide all(291)

miRTarBase ID	miRNA	Experiments	Reference
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT732970	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33451320
MIRT733363	hsa-miR-365a-3p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733364	hsa-miR-26b-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733365	hsa-miR-26a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733366	hsa-miR-146a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT732970	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC)	33451320
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT768807	hsa-miR-101	CLIP-seq
MIRT768808	hsa-miR-1228	CLIP-seq
MIRT768809	hsa-miR-1244	CLIP-seq
MIRT768810	hsa-miR-1252	CLIP-seq
MIRT768811	hsa-miR-1253	CLIP-seq
MIRT768812	hsa-miR-1262	CLIP-seq
MIRT768813	hsa-miR-1273f	CLIP-seq
MIRT768814	hsa-miR-1303	CLIP-seq
MIRT768815	hsa-miR-144	CLIP-seq
MIRT768816	hsa-miR-153	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768818	hsa-miR-199a-3p	CLIP-seq
MIRT768819	hsa-miR-199b-3p	CLIP-seq
MIRT768820	hsa-miR-224	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768822	hsa-miR-3119	CLIP-seq
MIRT768823	hsa-miR-3125	CLIP-seq
MIRT768824	hsa-miR-3129-5p	CLIP-seq
MIRT768825	hsa-miR-3153	CLIP-seq
MIRT768826	hsa-miR-3154	CLIP-seq
MIRT768827	hsa-miR-3173-3p	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT768830	hsa-miR-3613-3p	CLIP-seq
MIRT768831	hsa-miR-3672	CLIP-seq
MIRT768832	hsa-miR-371-5p	CLIP-seq
MIRT768833	hsa-miR-371b-5p	CLIP-seq
MIRT768834	hsa-miR-3916	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT768837	hsa-miR-4261	CLIP-seq
MIRT768838	hsa-miR-4311	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768840	hsa-miR-4428	CLIP-seq
MIRT768841	hsa-miR-4475	CLIP-seq
MIRT768842	hsa-miR-4476	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768844	hsa-miR-448	CLIP-seq
MIRT768845	hsa-miR-4484	CLIP-seq
MIRT768846	hsa-miR-4509	CLIP-seq
MIRT768847	hsa-miR-4517	CLIP-seq
MIRT768848	hsa-miR-4533	CLIP-seq
MIRT768849	hsa-miR-4534	CLIP-seq
MIRT768850	hsa-miR-4539	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT768852	hsa-miR-4653-3p	CLIP-seq
MIRT768853	hsa-miR-4668-5p	CLIP-seq
MIRT768854	hsa-miR-4680-5p	CLIP-seq
MIRT768855	hsa-miR-4701-3p	CLIP-seq
MIRT768856	hsa-miR-4714-3p	CLIP-seq
MIRT768857	hsa-miR-4715-5p	CLIP-seq
MIRT768858	hsa-miR-4724-5p	CLIP-seq
MIRT768859	hsa-miR-4744	CLIP-seq
MIRT768860	hsa-miR-4777-3p	CLIP-seq
MIRT768861	hsa-miR-4793-5p	CLIP-seq
MIRT768862	hsa-miR-4797-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768865	hsa-miR-508-5p	CLIP-seq
MIRT768866	hsa-miR-542-3p	CLIP-seq
MIRT768867	hsa-miR-548an	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT768869	hsa-miR-571	CLIP-seq
MIRT768870	hsa-miR-576-3p	CLIP-seq
MIRT768871	hsa-miR-582-5p	CLIP-seq
MIRT768872	hsa-miR-600	CLIP-seq
MIRT768873	hsa-miR-649	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq
MIRT768875	hsa-miR-661	CLIP-seq
MIRT768876	hsa-miR-759	CLIP-seq
MIRT768877	hsa-miR-766	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768880	hsa-miR-1226	CLIP-seq
MIRT768810	hsa-miR-1252	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768881	hsa-miR-24	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768882	hsa-miR-3185	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT768830	hsa-miR-3613-3p	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT768884	hsa-miR-3934	CLIP-seq
MIRT768885	hsa-miR-3945	CLIP-seq
MIRT768886	hsa-miR-4253	CLIP-seq
MIRT768887	hsa-miR-4267	CLIP-seq
MIRT768888	hsa-miR-4284	CLIP-seq
MIRT768838	hsa-miR-4311	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT768890	hsa-miR-4433	CLIP-seq
MIRT768842	hsa-miR-4476	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768848	hsa-miR-4533	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT768852	hsa-miR-4653-3p	CLIP-seq
MIRT768891	hsa-miR-4703-3p	CLIP-seq
MIRT768892	hsa-miR-4709-3p	CLIP-seq
MIRT768893	hsa-miR-4717-5p	CLIP-seq
MIRT768894	hsa-miR-4722-5p	CLIP-seq
MIRT768895	hsa-miR-4733-3p	CLIP-seq
MIRT768896	hsa-miR-4768-3p	CLIP-seq
MIRT768897	hsa-miR-4786-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768898	hsa-miR-499-3p	CLIP-seq
MIRT768899	hsa-miR-499a-3p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT768902	hsa-miR-570	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq
MIRT768903	hsa-miR-665	CLIP-seq
MIRT768904	hsa-miR-890	CLIP-seq
MIRT768905	hsa-miR-9	CLIP-seq
MIRT768906	hsa-miR-940	CLIP-seq
MIRT1920217	hsa-miR-186	CLIP-seq
MIRT1920218	hsa-miR-3133	CLIP-seq
MIRT1920219	hsa-miR-3647-3p	CLIP-seq
MIRT1920220	hsa-miR-577	CLIP-seq
MIRT1926733	hsa-miR-3145-5p	CLIP-seq
MIRT1926734	hsa-miR-3646	CLIP-seq
MIRT1926735	hsa-miR-3682-5p	CLIP-seq
MIRT1926736	hsa-miR-505	CLIP-seq
MIRT1926737	hsa-miR-606	CLIP-seq
MIRT2167691	hsa-miR-1208	CLIP-seq
MIRT768812	hsa-miR-1262	CLIP-seq
MIRT2167692	hsa-miR-1273e	CLIP-seq
MIRT768813	hsa-miR-1273f	CLIP-seq
MIRT2167693	hsa-miR-143	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT2167694	hsa-miR-187	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT2167695	hsa-miR-302f	CLIP-seq
MIRT1926733	hsa-miR-3145-5p	CLIP-seq
MIRT2167696	hsa-miR-3157-5p	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT2167698	hsa-miR-3622b-5p	CLIP-seq
MIRT2167699	hsa-miR-3664-3p	CLIP-seq
MIRT2167700	hsa-miR-3908	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167701	hsa-miR-3974	CLIP-seq
MIRT768887	hsa-miR-4267	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768890	hsa-miR-4433	CLIP-seq
MIRT2167704	hsa-miR-4434	CLIP-seq
MIRT2167705	hsa-miR-4457	CLIP-seq
MIRT2167706	hsa-miR-4459	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT2167707	hsa-miR-4516	CLIP-seq
MIRT2167708	hsa-miR-4535	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT2167709	hsa-miR-4691-3p	CLIP-seq
MIRT768855	hsa-miR-4701-3p	CLIP-seq
MIRT768891	hsa-miR-4703-3p	CLIP-seq
MIRT2167710	hsa-miR-4708-5p	CLIP-seq
MIRT768894	hsa-miR-4722-5p	CLIP-seq
MIRT768896	hsa-miR-4768-3p	CLIP-seq
MIRT2167711	hsa-miR-4770	CLIP-seq
MIRT2167712	hsa-miR-4776-5p	CLIP-seq
MIRT768897	hsa-miR-4786-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768865	hsa-miR-508-5p	CLIP-seq
MIRT2167713	hsa-miR-512-5p	CLIP-seq
MIRT2167714	hsa-miR-513b	CLIP-seq
MIRT768866	hsa-miR-542-3p	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT2167715	hsa-miR-597	CLIP-seq
MIRT2167716	hsa-miR-624	CLIP-seq
MIRT768875	hsa-miR-661	CLIP-seq
MIRT768903	hsa-miR-665	CLIP-seq
MIRT2167717	hsa-miR-668	CLIP-seq
MIRT2167718	hsa-miR-711	CLIP-seq
MIRT768877	hsa-miR-766	CLIP-seq
MIRT768904	hsa-miR-890	CLIP-seq
MIRT768906	hsa-miR-940	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT2470376	hsa-miR-4293	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT2470377	hsa-miR-4684-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT2470378	hsa-miR-596	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT2470376	hsa-miR-4293	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT2470377	hsa-miR-4684-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT2470378	hsa-miR-596	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
PPARG	Activation	20484463
PPARG	Unknown	18373719;19833717
SP1	Activation	12378384
TFAP2B	Repression	19325541

Show/Hide all(90)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18431508
GO:0005102	Function	Signaling receptor binding	ISS	12368907
GO:0005125	Function	Cytokine activity	NAS	12611609
GO:0005179	Function	Hormone activity	IDA	11222466
GO:0005201	Function	Extracellular matrix structural constituent	RCA	28675934
GO:0005515	Function	Protein binding	IPI	12070119, 25910212, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IDA	10403784, 15585515, 17327472
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006006	Process	Glucose metabolic process	ISS	12368907
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	10095105
GO:0006635	Process	Fatty acid beta-oxidation	ISS	12368907
GO:0007165	Process	Signal transduction	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0009749	Process	Response to glucose	ISS	12368907
GO:0009967	Process	Positive regulation of signal transduction	ISS	12368907
GO:0009986	Component	Cell surface	IDA	10982546
GO:0010467	Process	Gene expression	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	12070119
GO:0010739	Process	Positive regulation of protein kinase A signaling	IDA	10982546
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	11222466
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	10604883
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	18703020
GO:0010906	Process	Regulation of glucose metabolic process	IDA	17327472
GO:0014823	Process	Response to activity	IEA
GO:0019395	Process	Fatty acid oxidation	ISS
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030853	Process	Negative regulation of granulocyte differentiation	IDA	10961870
GO:0031953	Process	Negative regulation of protein autophosphorylation	IDA	12070119
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	10961870
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0033034	Process	Positive regulation of myeloid cell apoptotic process	IDA	10961870
GO:0033691	Function	Sialic acid binding	IDA	19855092
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	10604883
GO:0034383	Process	Low-density lipoprotein particle clearance	IDA	11222466
GO:0034612	Process	Response to tumor necrosis factor	IDA	10604883
GO:0035690	Process	Cellular response to drug	ISS
GO:0042304	Process	Regulation of fatty acid biosynthetic process	TAS
GO:0042593	Process	Glucose homeostasis	ISS	12368907
GO:0042802	Function	Identical protein binding	TAS	10961870
GO:0042803	Function	Protein homodimerization activity	IPI	12021245
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	10982546
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	12021245
GO:0045650	Process	Negative regulation of macrophage differentiation	IDA	10961870
GO:0045721	Process	Negative regulation of gluconeogenesis	ISS	12368907
GO:0045776	Process	Negative regulation of blood pressure	IDA	17327472
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	18431508
GO:0045923	Process	Positive regulation of fatty acid metabolic process	ISS	12368907
GO:0046326	Process	Positive regulation of glucose import	ISS	12368907
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050728	Process	Negative regulation of inflammatory response	NAS	12611609
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050765	Process	Negative regulation of phagocytosis	IDA	10961870
GO:0050805	Process	Negative regulation of synaptic transmission	IDA	17327472
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	28675934
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	12070119
GO:0070543	Process	Response to linoleic acid	IEA
GO:0070994	Process	Detection of oxidative stress	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	18431508
GO:0090317	Process	Negative regulation of intracellular protein transport	IDA	18431508
GO:0110113	Process	Positive regulation of lipid transporter activity	IDA	18703020
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:1900121	Process	Negative regulation of receptor binding	IDA	12070119
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	12070119
GO:1904753	Process	Negative regulation of vascular associated smooth muscle cell migration	IDA	12070119
GO:1905598	Process	Negative regulation of low-density lipoprotein receptor activity	IDA	11222466
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	12070119
GO:2000467	Process	Positive regulation of glycogen (starch) synthase activity	ISS
GO:2000478	Process	Positive regulation of metanephric glomerular visceral epithelial cell development	ISS
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IDA	18431508, 19524870
GO:2000534	Process	Positive regulation of renal albumin absorption	IDA	18431508
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS
GO:2000590	Process	Negative regulation of metanephric mesenchymal cell migration	ISS

MIM	HGNC	e!Ensembl
605441	13633	ENSG00000181092

Protein

UniProt ID

Q15848

Protein name

Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)

Protein function

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal mus

PDB

4DOU , 6U66 , 6U6N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	37 → 108	Collagen triple helix repeat (20 copies)	Repeat
PF00386	C1q	114 → 239	C1q domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Synthesized exclusively by adipocytes and secreted into plasma. {ECO:0000269|PubMed:8947845}.

Sequence

MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN

Sequence length

244

Interactions

View interactions

ADIPOQ (adiponectin, C1Q and collagen domain containing)