Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	109
Gene name	Adenylate cyclase 3
Gene symbol	ADCY3
Synonyms (NCBI Gene)	AC-IIIAC3BMIQ19
Chromosome	2
Chromosome location	2p23.3
Summary	This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involv

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs754914420	C>-,CC	Risk-factor	Coding sequence variant, frameshift variant
rs1331776405	C>T	Risk-factor	Splice acceptor variant, intron variant
rs1553333167	C>T	Risk-factor	Splice acceptor variant

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022973	hsa-miR-124-3p	Microarray	18668037
MIRT037340	hsa-miR-877-5p	CLASH	23622248
MIRT036106	hsa-miR-1296-5p	CLASH	23622248
MIRT035974	hsa-miR-1301-3p	CLASH	23622248
MIRT737113	hsa-miR-423-5p	Western blottingRNA-seqqRT-PCR	32462942
MIRT768001	hsa-miR-1299	CLIP-seq
MIRT768002	hsa-miR-3169	CLIP-seq
MIRT768003	hsa-miR-3202	CLIP-seq
MIRT768004	hsa-miR-4533	CLIP-seq
MIRT768005	hsa-miR-4721	CLIP-seq
MIRT768006	hsa-miR-760	CLIP-seq
MIRT768007	hsa-miR-875-3p	CLIP-seq
MIRT1926511	hsa-miR-125a-3p	CLIP-seq
MIRT1926512	hsa-miR-3117-5p	CLIP-seq
MIRT1926513	hsa-miR-3144-5p	CLIP-seq
MIRT1926514	hsa-miR-3191	CLIP-seq
MIRT1926515	hsa-miR-331-3p	CLIP-seq
MIRT1926516	hsa-miR-3670	CLIP-seq
MIRT1926517	hsa-miR-4269	CLIP-seq
MIRT1926518	hsa-miR-4438	CLIP-seq
MIRT1926519	hsa-miR-4652-5p	CLIP-seq
MIRT1926520	hsa-miR-4667-5p	CLIP-seq
MIRT1926521	hsa-miR-4700-5p	CLIP-seq
MIRT1926522	hsa-miR-4722-3p	CLIP-seq
MIRT1926523	hsa-miR-4728-3p	CLIP-seq
MIRT1926524	hsa-miR-4731-5p	CLIP-seq
MIRT1926525	hsa-miR-4755-3p	CLIP-seq
MIRT1926526	hsa-miR-5095	CLIP-seq
MIRT1926527	hsa-miR-605	CLIP-seq
MIRT1926516	hsa-miR-3670	CLIP-seq
MIRT2435209	hsa-miR-1178	CLIP-seq
MIRT2435210	hsa-miR-128	CLIP-seq
MIRT2435211	hsa-miR-1976	CLIP-seq
MIRT2435212	hsa-miR-27a	CLIP-seq
MIRT2435213	hsa-miR-27b	CLIP-seq
MIRT2435214	hsa-miR-3545-5p	CLIP-seq
MIRT2435215	hsa-miR-370	CLIP-seq
MIRT2435216	hsa-miR-4667-3p	CLIP-seq
MIRT2435217	hsa-miR-4715-3p	CLIP-seq
MIRT2435218	hsa-miR-767-3p	CLIP-seq
MIRT2435209	hsa-miR-1178	CLIP-seq
MIRT2443190	hsa-miR-1207-5p	CLIP-seq
MIRT2443191	hsa-miR-1266	CLIP-seq
MIRT2435210	hsa-miR-128	CLIP-seq
MIRT2435211	hsa-miR-1976	CLIP-seq
MIRT2435212	hsa-miR-27a	CLIP-seq
MIRT2435213	hsa-miR-27b	CLIP-seq
MIRT2443192	hsa-miR-296-5p	CLIP-seq
MIRT2443193	hsa-miR-3127-5p	CLIP-seq
MIRT2443194	hsa-miR-3150b-3p	CLIP-seq
MIRT2435214	hsa-miR-3545-5p	CLIP-seq
MIRT2443195	hsa-miR-3646	CLIP-seq
MIRT2443196	hsa-miR-3659	CLIP-seq
MIRT2435215	hsa-miR-370	CLIP-seq
MIRT2443197	hsa-miR-377	CLIP-seq
MIRT2443198	hsa-miR-3918	CLIP-seq
MIRT2443199	hsa-miR-3929	CLIP-seq
MIRT2443200	hsa-miR-4263	CLIP-seq
MIRT2443201	hsa-miR-4325	CLIP-seq
MIRT2443202	hsa-miR-4419b	CLIP-seq
MIRT2443203	hsa-miR-4476	CLIP-seq
MIRT2443204	hsa-miR-4478	CLIP-seq
MIRT2443205	hsa-miR-4493	CLIP-seq
MIRT2443206	hsa-miR-4518	CLIP-seq
MIRT2443207	hsa-miR-4658	CLIP-seq
MIRT2435216	hsa-miR-4667-3p	CLIP-seq
MIRT2443208	hsa-miR-4688	CLIP-seq
MIRT2443209	hsa-miR-4689	CLIP-seq
MIRT2435217	hsa-miR-4715-3p	CLIP-seq
MIRT2443210	hsa-miR-4749-3p	CLIP-seq
MIRT2443211	hsa-miR-4763-3p	CLIP-seq
MIRT2443212	hsa-miR-4784	CLIP-seq
MIRT2443213	hsa-miR-4799-5p	CLIP-seq
MIRT2443214	hsa-miR-493	CLIP-seq
MIRT2443215	hsa-miR-574-5p	CLIP-seq
MIRT2443216	hsa-miR-576-5p	CLIP-seq
MIRT2443217	hsa-miR-648	CLIP-seq
MIRT2443218	hsa-miR-665	CLIP-seq
MIRT2435218	hsa-miR-767-3p	CLIP-seq
MIRT2443194	hsa-miR-3150b-3p	CLIP-seq
MIRT2443195	hsa-miR-3646	CLIP-seq
MIRT2443196	hsa-miR-3659	CLIP-seq
MIRT2443197	hsa-miR-377	CLIP-seq
MIRT2443199	hsa-miR-3929	CLIP-seq
MIRT2443200	hsa-miR-4263	CLIP-seq
MIRT2443201	hsa-miR-4325	CLIP-seq
MIRT2443202	hsa-miR-4419b	CLIP-seq
MIRT2443203	hsa-miR-4476	CLIP-seq
MIRT2443204	hsa-miR-4478	CLIP-seq
MIRT2443205	hsa-miR-4493	CLIP-seq
MIRT2443207	hsa-miR-4658	CLIP-seq
MIRT2443209	hsa-miR-4689	CLIP-seq
MIRT2443212	hsa-miR-4784	CLIP-seq
MIRT2443213	hsa-miR-4799-5p	CLIP-seq
MIRT2443214	hsa-miR-493	CLIP-seq
MIRT2443215	hsa-miR-574-5p	CLIP-seq
MIRT2443216	hsa-miR-576-5p	CLIP-seq
MIRT2443217	hsa-miR-648	CLIP-seq
MIRT2443218	hsa-miR-665	CLIP-seq
MIRT2435209	hsa-miR-1178	CLIP-seq
MIRT2435210	hsa-miR-128	CLIP-seq
MIRT2435211	hsa-miR-1976	CLIP-seq
MIRT2435212	hsa-miR-27a	CLIP-seq
MIRT2435213	hsa-miR-27b	CLIP-seq
MIRT2443192	hsa-miR-296-5p	CLIP-seq
MIRT2443193	hsa-miR-3127-5p	CLIP-seq
MIRT2435214	hsa-miR-3545-5p	CLIP-seq
MIRT2435215	hsa-miR-370	CLIP-seq
MIRT2443198	hsa-miR-3918	CLIP-seq
MIRT2435216	hsa-miR-4667-3p	CLIP-seq
MIRT2435217	hsa-miR-4715-3p	CLIP-seq
MIRT2435218	hsa-miR-767-3p	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004016	Function	Adenylate cyclase activity	IBA
GO:0004016	Function	Adenylate cyclase activity	IEA
GO:0004016	Function	Adenylate cyclase activity	ISS
GO:0004016	Function	Adenylate cyclase activity	TAS	9920776
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11549699
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11549699
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	9920776
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0006171	Process	CAMP biosynthetic process	IBA
GO:0006171	Process	CAMP biosynthetic process	IEA
GO:0006171	Process	CAMP biosynthetic process	ISS
GO:0007165	Process	Signal transduction	TAS	9920776
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007338	Process	Single fertilization	IEA
GO:0007338	Process	Single fertilization	ISS
GO:0007340	Process	Acrosome reaction	IEA
GO:0007340	Process	Acrosome reaction	ISS
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	ISS
GO:0008355	Process	Olfactory learning	IEA
GO:0008355	Process	Olfactory learning	ISS
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0060170	Component	Ciliary membrane	ISS
GO:1904322	Process	Cellular response to forskolin	IEA
GO:1904322	Process	Cellular response to forskolin	ISS

MIM	HGNC	e!Ensembl
600291	234	ENSG00000138031

O60266

Protein name

Adenylate cyclase type 3 (EC 4.6.1.1) (ATP pyrophosphate-lyase 3) (Adenylate cyclase type III) (AC-III) (Adenylate cyclase, olfactive type) (Adenylyl cyclase 3) (AC3)

Protein function

Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling. Participates in signaling cascades triggered by odorant receptors via its function in cAMP biosynthesis: specifically activated by G alpha protein GNAL/G(

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16214	AC_N	24 → 306	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
PF00211	Guanylate_cyc	310 → 493	Adenylate and Guanylate cyclase catalytic domain	Domain
PF00211	Guanylate_cyc	914 → 1121	Adenylate and Guanylate cyclase catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in zona glomerulosa and zona fasciculata in the adrenal gland (at protein level) (PubMed:11549699). Expressed in brain, heart, kidney, liver, lung, pancreas islets, placenta, and skeletal muscle (PubMed:9920776). Detected in t

Sequence

MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVLPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV
VDNS

Sequence length

1144

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (28)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ADCY3-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BODY MASS INDEX QUANTITATIVE TRAIT LOCUS 19	Uncertain significance; risk factor	ClinVar ClinVar, GWAS catalog ClinVar, GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY, MORBID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	34727921	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	29748622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	24243566	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	32037372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Traumatic Encephalopathy	Associate	29338612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cysts	Associate	22952279	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	27322064	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	27322064, 29311636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	32698306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrous Dysplasia Polyostotic	Associate	26651848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Genetic Diseases Inborn	Associate	32699307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	32698306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	25766683	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	39519366	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	37832654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	32699307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24243566	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	32698306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	21079816, 21840420, 26449484, 27322064, 29311636, 29921800, 32153512, 34207686, 34821371, 35026759, 36775011, 36839421, 37000968, 37329217, 39519366, 39766774 View all (1 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Overweight	Associate	39766774	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pigmentation Disorders	Associate	32699307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Associate	22952279	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	30106120, 35036435	★★★★★ ★☆☆☆☆ Found in Text Mining only
Weight Loss	Associate	29921800	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADCY3 (adenylate cyclase 3)