Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9429
Gene name Gene Name - the full gene name approved by the HGNC.	ATP binding cassette subfamily G member 2 (JR blood group)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ABCG2
Synonyms (NCBI Gene) Gene synonyms aliases	ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, CDw388, EST157481, GOUT1, MRX, MXR, MXR-1, MXR1, UAQTL1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2231137	C>T	Association, affects	Coding sequence variant, missense variant
rs2231142	G>C,T	Not-provided, association, drug-response	Coding sequence variant, missense variant
rs200190472	G>A	Affects	Coding sequence variant, stop gained
rs387906869	TG>-	Affects	Coding sequence variant, frameshift variant
rs387906870	AA>-	Affects	Coding sequence variant, frameshift variant

Show/Hide all(136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001952	hsa-miR-520h	Luciferase reporter assay	18189265
MIRT000998	hsa-miR-519c-3p	Western blot, Luciferase reporter assay, qRT-PCR	18573883
MIRT000998	hsa-miR-519c-3p	Luciferase reporter assay	19825807
MIRT001952	hsa-miR-520h	Luciferase reporter assay	19825807
MIRT000081	hsa-miR-328-3p	Review	20026422
MIRT004129	hsa-miR-192-5p	Microarray	16822819
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	19270061
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	19270061
MIRT001952	hsa-miR-520h	qRT-PCR, Western blot	20628378
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT001952	hsa-miR-520h	Microarray	18189265
MIRT000081	hsa-miR-328-3p	Reporter assay;Western blot;qRT-PCR;Other	19270061
MIRT029929	hsa-miR-26b-5p	Microarray	19088304
MIRT047731	hsa-miR-10a-5p	CLASH	23622248
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	22453125
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437871	hsa-miR-142-3p	Luciferase reporter assay, Western blot	23619912
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT526193	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526192	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526191	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT526190	hsa-miR-4539	PAR-CLIP	22012620
MIRT526189	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT526188	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT444289	hsa-miR-369-3p	PAR-CLIP	22100165
MIRT444287	hsa-miR-5692b	PAR-CLIP	22100165
MIRT444288	hsa-miR-5692c	PAR-CLIP	22100165
MIRT444286	hsa-miR-16-2-3p	PAR-CLIP	22100165
MIRT444285	hsa-miR-195-3p	PAR-CLIP	22100165
MIRT444284	hsa-miR-4635	PAR-CLIP	22100165
MIRT444283	hsa-miR-3167	PAR-CLIP	22100165
MIRT444282	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT444281	hsa-miR-889-3p	PAR-CLIP	22100165
MIRT444280	hsa-miR-374a-5p	PAR-CLIP	22100165
MIRT444279	hsa-miR-374b-5p	PAR-CLIP	22100165
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31701195
MIRT526193	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526192	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526191	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT526190	hsa-miR-4539	PAR-CLIP	22012620
MIRT526189	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT526188	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT444289	hsa-miR-369-3p	PAR-CLIP	22100165
MIRT444287	hsa-miR-5692b	PAR-CLIP	22100165
MIRT444288	hsa-miR-5692c	PAR-CLIP	22100165
MIRT444286	hsa-miR-16-2-3p	PAR-CLIP	22100165
MIRT444285	hsa-miR-195-3p	PAR-CLIP	22100165
MIRT444284	hsa-miR-4635	PAR-CLIP	22100165
MIRT444283	hsa-miR-3167	PAR-CLIP	22100165
MIRT444282	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT444281	hsa-miR-889-3p	PAR-CLIP	22100165
MIRT444280	hsa-miR-374a-5p	PAR-CLIP	22100165
MIRT444279	hsa-miR-374b-5p	PAR-CLIP	22100165
MIRT759231	hsa-miR-1185	CLIP-seq
MIRT759232	hsa-miR-1206	CLIP-seq
MIRT759233	hsa-miR-1294	CLIP-seq
MIRT759234	hsa-miR-2054	CLIP-seq
MIRT759235	hsa-miR-2117	CLIP-seq
MIRT759236	hsa-miR-3120-3p	CLIP-seq
MIRT759237	hsa-miR-3137	CLIP-seq
MIRT759238	hsa-miR-3144-3p	CLIP-seq
MIRT759239	hsa-miR-3202	CLIP-seq
MIRT759240	hsa-miR-3545-5p	CLIP-seq
MIRT759241	hsa-miR-3605-5p	CLIP-seq
MIRT759242	hsa-miR-3613-3p	CLIP-seq
MIRT759243	hsa-miR-3614-5p	CLIP-seq
MIRT759244	hsa-miR-365	CLIP-seq
MIRT759245	hsa-miR-3679-5p	CLIP-seq
MIRT759246	hsa-miR-3908	CLIP-seq
MIRT759247	hsa-miR-3936	CLIP-seq
MIRT759248	hsa-miR-3942-5p	CLIP-seq
MIRT759249	hsa-miR-4273	CLIP-seq
MIRT759250	hsa-miR-4316	CLIP-seq
MIRT759251	hsa-miR-4433	CLIP-seq
MIRT759252	hsa-miR-4470	CLIP-seq
MIRT759253	hsa-miR-4475	CLIP-seq
MIRT759254	hsa-miR-4477a	CLIP-seq
MIRT759255	hsa-miR-4501	CLIP-seq
MIRT759256	hsa-miR-4659a-5p	CLIP-seq
MIRT759257	hsa-miR-4659b-5p	CLIP-seq
MIRT759258	hsa-miR-4680-3p	CLIP-seq
MIRT759259	hsa-miR-4687-3p	CLIP-seq
MIRT759260	hsa-miR-4703-5p	CLIP-seq
MIRT759261	hsa-miR-4716-5p	CLIP-seq
MIRT759262	hsa-miR-4729	CLIP-seq
MIRT759263	hsa-miR-4747-5p	CLIP-seq
MIRT759264	hsa-miR-4766-3p	CLIP-seq
MIRT759265	hsa-miR-487a	CLIP-seq
MIRT759266	hsa-miR-499-3p	CLIP-seq
MIRT759267	hsa-miR-499a-3p	CLIP-seq
MIRT759268	hsa-miR-548c-3p	CLIP-seq
MIRT759269	hsa-miR-577	CLIP-seq
MIRT759270	hsa-miR-579	CLIP-seq
MIRT759271	hsa-miR-607	CLIP-seq
MIRT759272	hsa-miR-616	CLIP-seq
MIRT759273	hsa-miR-647	CLIP-seq
MIRT759274	hsa-miR-665	CLIP-seq
MIRT1923775	hsa-miR-105	CLIP-seq
MIRT1923776	hsa-miR-1305	CLIP-seq
MIRT1923777	hsa-miR-145	CLIP-seq
MIRT1923778	hsa-miR-3148	CLIP-seq
MIRT1923779	hsa-miR-3180-5p	CLIP-seq
MIRT1923780	hsa-miR-4427	CLIP-seq
MIRT759258	hsa-miR-4680-3p	CLIP-seq
MIRT1923781	hsa-miR-4712-5p	CLIP-seq
MIRT759262	hsa-miR-4729	CLIP-seq
MIRT1923782	hsa-miR-4796-3p	CLIP-seq
MIRT1923783	hsa-miR-548t	CLIP-seq
MIRT1923784	hsa-miR-590-3p	CLIP-seq
MIRT1923785	hsa-miR-770-5p	CLIP-seq
MIRT1923775	hsa-miR-105	CLIP-seq
MIRT759234	hsa-miR-2054	CLIP-seq
MIRT759239	hsa-miR-3202	CLIP-seq
MIRT2165278	hsa-miR-4261	CLIP-seq
MIRT2165279	hsa-miR-4282	CLIP-seq
MIRT759253	hsa-miR-4475	CLIP-seq
MIRT2165280	hsa-miR-4645-3p	CLIP-seq
MIRT2165281	hsa-miR-4652-3p	CLIP-seq
MIRT2165282	hsa-miR-4714-3p	CLIP-seq
MIRT759263	hsa-miR-4747-5p	CLIP-seq
MIRT2165283	hsa-miR-501-3p	CLIP-seq
MIRT2165284	hsa-miR-502-3p	CLIP-seq
MIRT2165285	hsa-miR-891b	CLIP-seq
MIRT2383765	hsa-miR-3927	CLIP-seq
MIRT2383766	hsa-miR-493	CLIP-seq

Transcription factors

Show/Hide all(10)

Transcription factor	Regulation	Reference
AHR	Unknown	20460431
ESR1	Unknown	10342828
MSX2	Unknown	21465479
NFKB1	Activation	10342828
PGR	Unknown	22348324
PPARG	Activation	16785230
RELA	Activation	10342828
SALL4A	Unknown	21526180
SMARCA4	Activation	18234970
SP1	Unknown	21465479

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18056989, 19909340
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	18619525, 23137377
GO:0005886	Component	Plasma membrane	TAS
GO:0006879	Process	Cellular iron ion homeostasis	TAS
GO:0008514	Function	Organic anion transmembrane transporter activity	ISS
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	9861027
GO:0015143	Function	Urate transmembrane transporter activity	IMP	19506252
GO:0015225	Function	Biotin transmembrane transporter activity	ISS
GO:0015562	Function	Efflux transmembrane transporter activity	IMP	17145775, 19506252
GO:0015562	Function	Efflux transmembrane transporter activity	ISS
GO:0015711	Process	Organic anion transport	ISS
GO:0015747	Process	Urate transport	IEA
GO:0015878	Process	Biotin transport	ISS
GO:0016021	Component	Integral component of membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0031526	Component	Brush border membrane	IDA	19506252
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032217	Function	Riboflavin transmembrane transporter activity	IDA	17145775
GO:0032218	Process	Riboflavin transport	IDA	17145775
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IMP	28554189, 30405239
GO:0042802	Function	Identical protein binding	IPI	16870176, 17098188, 19506252, 20399185
GO:0042803	Function	Protein homodimerization activity	IDA	16870176
GO:0042910	Function	Xenobiotic transmembrane transporter activity	ISS
GO:0045121	Component	Membrane raft	IDA	28623970
GO:0046415	Process	Urate metabolic process	IMP	18834626, 19503597, 20053405
GO:0055085	Process	Transmembrane transport	IMP	28554189, 30405239
GO:0070633	Process	Transepithelial transport	IDA	12958161
GO:0097744	Process	Urate salt excretion	IMP	19506252
GO:0098591	Component	External side of apical plasma membrane	ISS	18619525
GO:0140115	Process	Export across plasma membrane	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1990748	Process	Cellular detoxification	IDA	9861027
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IC
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IDA	12958161

MIM	HGNC	e!Ensembl
603756	74	ENSG00000118777

Protein

UniProt ID

Q9UNQ0

Protein name

Broad substrate specificity ATP-binding cassette transporter ABCG2 (EC 7.6.2.2) (ATP-binding cassette sub-family G member 2) (Breast cancer resistance protein) (CDw338) (Mitoxantrone resistance-associated protein) (Placenta-specific ATP-binding cassette t

Protein function

Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells (PubMed:11306452, PubMed:12958161, PubMed:

PDB

5NJ3 , 5NJG , 6ETI , 6FEQ , 6FFC , 6HBU , 6HCO , 6HIJ , 6HZM , 6VXF , 6VXH , 6VXI , 6VXJ , 7NEQ , 7NEZ , 7NFD , 7OJ8 , 7OJH , 7OJI , 8BHT , 8BI0 , 8P7W , 8P8A , 8P8J , 8PXO , 8PY4 , 8Q7B , 8QCM , 8U2C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00005	ABC_tran	64 → 214	ABC transporter	Domain
PF19055	ABC2_membrane_7	243 → 321	ABC-2 type transporter	Family
PF01061	ABC2_membrane	375 → 586	ABC-2 type transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta (PubMed:9850061). Low expression in small intestine, liver and colon (PubMed:9861027). Expressed in brain (at protein level) (PubMed:12958161). {ECO:0000269|PubMed:12958161, ECO:0000269|PubMed:9850061, ECO:

Sequence

MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS

Sequence length

655

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Gout	Gout	GWAS
Hyperuricemia	Hyperuricemia	GWAS
Urolithiasis	Urolithiasis	GWAS
Dental caries	Dental caries	GWAS
Dementia	Dementia	GWAS

Show/Hide Text Mining Associations (222)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	15146167, 34065402
Adenocarcinoma of Lung	Associate	24528019, 32142727
Adenoma	Inhibit	25793771
Adrenocortical Carcinoma	Inhibit	36555598
Adult i Blood Group with Congenital Cataract	Associate	33003314
Alzheimer Disease	Associate	33115695
Amyotrophic Lateral Sclerosis	Associate	31999342
Anemia sideroblastic spinocerebellar ataxia	Associate	30765471
Anorexia	Associate	34924131
Arthritis Gouty	Associate	26552468, 31367212, 35939175, 36221101
Arthritis Rheumatoid	Associate	19248091
Ascites	Associate	30526541
Astrocytoma	Stimulate	15946326
Asymptomatic Diseases	Associate	36221101
Atherosclerosis	Associate	20185793
Autoimmune Diseases	Associate	40023574
Bacterial Infections	Inhibit	31561453
Bacterial Infections	Associate	33427563
Biliary Tract Neoplasms	Associate	31590928
Bipolar Disorder	Associate	24393808
Brain Diseases	Associate	15946326, 34008992
Brain Injuries Traumatic	Associate	28747144
Brain Neoplasms	Associate	15946326, 23632480, 27052877
Breast Neoplasms	Associate	12100141, 15047700, 15139851, 15521915, 15930306, 16367905, 16847575, 16925584, 17445775, 18377430, 19165709, 19270061, 19514121, 20004175, 20110355 View all (52 more)
Breast Neoplasms	Stimulate	30055962
Carcinogenesis	Associate	23838136, 25793771, 26178481, 27709738, 37445716
Carcinoma Adenoid Cystic	Associate	24804195
Carcinoma Ductal Breast	Associate	21943250, 22452996
Carcinoma Hepatocellular	Associate	17456779, 23153066, 23317196, 29467213, 34031441, 36614168, 37171695
Carcinoma in Situ	Associate	27584160
Carcinoma Medullary	Associate	38019248
Carcinoma Non Small Cell Lung	Associate	16542215, 17534875, 20082278, 20975373, 21332310, 21455636, 26536031, 28340578, 29751792, 31952518, 34326700
Carcinoma Non Small Cell Lung	Stimulate	26911281, 26943330
Carcinoma Ovarian Epithelial	Associate	22112610
Carcinoma Pancreatic Ductal	Associate	26178481, 29444383, 32629871
Carcinoma Renal Cell	Associate	16954373, 23467750, 28347288, 35676859, 36555598
Carcinoma Squamous Cell	Associate	31952518
Cardiomyopathy Dilated	Associate	36769209
Cardiotoxicity	Associate	34887513
Castleman Disease	Associate	19139722
Cerebral Infarction	Associate	19023099
Chemical and Drug Induced Liver Injury	Associate	35414164
Cholangiocarcinoma	Associate	36158120, 40282409
Cholestasis	Inhibit	25798860
Chorioamnionitis	Associate	29402780
Chronic Kidney Disease Mineral and Bone Disorder	Associate	27249515, 31367212
Cleft Lip	Associate	31392390
Colitis Ulcerative	Associate	33686088
Colonic Neoplasms	Associate	20804740
Colonic Neoplasms	Inhibit	37445716
Colorectal Neoplasms	Associate	18573883, 21133588, 22870247, 23558935, 23838136, 24023782, 24338217, 24351404, 25198900, 25793771, 26176272, 27257141, 28212529, 29969677, 31608899 View all (7 more)
Coronary Disease	Associate	25634581
Death	Associate	24151392, 26059733
Dental Caries	Associate	28100911, 36567334
Dermatitis Phototoxic	Associate	30445362
Diabetes Mellitus	Associate	21866211, 22558111, 24255036, 30610963, 31315286
Diabetes Mellitus Type 2	Associate	27328642, 33531564, 34855903
Diabetic Foot	Associate	31315286
Diarrhea	Associate	19032367, 21332310
Disease	Associate	28270222
Disease Resistance	Associate	15362954, 20019844, 22701315, 24032744, 24380367
DNA Virus Infections	Associate	27389299
Drug Hypersensitivity	Associate	31736281
Drug Related Side Effects and Adverse Reactions	Associate	16130519, 19032367, 21245102, 22401348, 22449016, 25340731, 27741279, 28049953, 28698656, 30610963, 31254042, 31987794, 32737955, 33333736, 33805426, 36614168 View all (1 more)
Drug Resistant Epilepsy	Associate	18509645, 20922799, 22401348, 24903205, 35338956
Drug Resistant Epilepsy	Stimulate	28273590
Dyslipidemias	Associate	32183743
Dysplastic Nevus Syndrome	Associate	17456779
Ectodermal Dysplasia	Associate	36555598
Endometrial Neoplasms	Inhibit	22925688
Endometrial Neoplasms	Associate	33917029, 36555598
Endometriosis	Associate	22925688
Ependymoma	Associate	20406235
Epilepsy	Associate	15946326
Epilepsy Familial Mesial Temporal Lobe	Stimulate	28273590
Epilepsy Familial Mesial Temporal Lobe	Associate	30030837
Epilepsy Idiopathic Generalized	Associate	35338956
Esophageal Squamous Cell Carcinoma	Associate	36474162
Exanthema	Associate	22515119
Fatigue	Associate	18509645
Fetal Growth Retardation	Associate	31561453
Fetal Growth Retardation	Inhibit	34537452
Fever	Stimulate	25988710
Fever	Inhibit	33333736
Fibrosis	Stimulate	23462698
Focal Cortical Dysplasia	Associate	28273590
Gastrointestinal Diseases	Associate	18309947
Gastrointestinal Stromal Tumors	Associate	28335376, 36942304
Glioblastoma	Associate	22401348, 24380367, 25359730, 28019039
Glioblastoma	Inhibit	36555598
Glioma	Associate	32238732, 35390338
Glycosuria Renal	Associate	24441388, 25646370, 30894219
Gout	Associate	18834626, 19890391, 22541845, 23552988, 23774753, 24441388, 24476385, 24857923, 24869748, 24909660, 25326865, 25646370, 25867401, 26427508, 26552468 View all (30 more)
Head and Neck Neoplasms	Associate	22009787
Heart Diseases	Associate	22736676, 24857923, 24869748, 31003562, 32180207
Heart Septal Defects Ventricular	Associate	24979295
HELLP Syndrome	Inhibit	25446997
Hematologic Neoplasms	Associate	21918980
Hemorrhage	Associate	37641689
HIV Infections	Associate	26902756
Hypercholesterolemia	Associate	25867401, 34631016, 40532247
Hypertension	Associate	32183743, 34855903, 35505381
Hypertriglyceridemia	Associate	25867401, 32183743
Hyperuricemia	Associate	23238572, 23665398, 24441388, 24476385, 24869748, 24909660, 25867401, 26792383, 28252667, 28458315, 28776340, 29453348, 30197413, 30621105, 30894219 View all (14 more)
Hyperuricemia	Inhibit	29317200
Hypouricemia Renal 2	Associate	32375679
Hypoxia	Stimulate	22216200, 26785721, 32142727
Hypoxia	Associate	22452996, 26091795, 28049953
Hypoxia Brain	Stimulate	26785721
Infections	Associate	26578453, 31561453, 33427563, 36721242
Inflammation	Associate	19520157, 19629677, 25111504, 29453348, 31561453, 34680995
Inflammation	Stimulate	30030837
Inflammation	Inhibit	30214039
Inflammatory Bowel Diseases	Associate	31211831
Insulin Resistance	Associate	32375679
Intrahepatic Cholestasis of Pregnancy	Associate	25099365
Iron Overload	Associate	24441388, 25646370, 30894219
Jaundice	Associate	27249515
Kidney Diseases	Associate	31367212, 35505381
Kidney Failure Chronic	Associate	34855903
Leukemia	Associate	16051742, 18200595, 18249061, 19635183, 20019844, 30551474, 33650639
Leukemia Lymphocytic Chronic B Cell	Associate	19635183, 21918980, 26354214, 36077209
Leukemia Megakaryoblastic Acute	Associate	21640380
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16627755, 21693596, 23117072, 24123600, 24603487, 26250462, 29510895, 32027818
Leukemia Myeloid	Associate	21245102
Leukemia Myeloid Acute	Associate	10891476, 11986234, 12393637, 17340137, 18200595, 19846953, 21523728, 21640380, 22508650, 26059733, 27178373, 30766560
Leukemia Myeloid Chronic Phase	Associate	23716542
Leukoplakia Oral	Associate	22009787
Limbal Stem Cell Deficiency	Associate	28813511
Liposarcoma	Associate	23047249
Liver Cirrhosis	Associate	27543206, 40282409
Liver Cirrhosis Alcoholic	Stimulate	23462698
Liver Diseases	Associate	37641689
Liver Failure	Associate	25798860
Lung Neoplasms	Associate	16542215, 18219662, 18588889, 18612434, 19132374, 23996530, 24939447, 25988710, 26536031, 27911857, 32142727, 32478948
Lupus Erythematosus Systemic	Inhibit	40023574
Lymphatic Metastasis	Associate	21943250, 23838136
Lymphatic Metastasis	Stimulate	26178481
Lymphoma	Associate	21918980
Lymphoma B Cell	Associate	21918980
Lymphoma Large B Cell Diffuse	Associate	19032367, 19593328, 21625222
Lymphoma Non Hodgkin	Associate	21918980
Lymphoma Primary Effusion	Associate	21660043
Medulloblastoma	Associate	25966102, 30445362
Melanoma	Associate	25300205, 26494317, 28293855, 34296805, 37796710, 39766280
Metabolic Syndrome	Associate	24827988, 35505381
Mohr Tranebjaerg syndrome	Associate	30146342
Mouth Diseases	Associate	24415717
Mouth Neoplasms	Associate	22009787, 23804138, 32957726, 34092610
Mucositis	Associate	34614057, 36982571
Multiple Myeloma	Associate	16917002, 30664164
Multiple Myeloma	Inhibit	32552614
Multiple Sclerosis	Associate	33363050
Musculoskeletal Diseases	Associate	35152405
Myotonic Dystrophy	Associate	22558111
Myotoxicity	Associate	29950617
Nausea	Associate	25340731
Neoplasm Invasiveness	Stimulate	16556617
Neoplasm Metastasis	Associate	21133588, 23283439, 23838136, 26091795, 28347288, 33566445
Neoplasms	Associate	12668685, 15146167, 15330166, 15362954, 15930306, 16051742, 16556617, 17312388, 17456779, 18240351, 18382425, 18573883, 19132374, 19270061, 19479068 View all (103 more)
Neoplasms	Stimulate	15946326, 26785721
Neoplasms	Inhibit	25793771, 28282800, 36555598, 37445716
Neoplasms Squamous Cell	Associate	23244569, 27584160
Nephrolithiasis	Associate	31367212, 36967798
Nerve Degeneration	Associate	20583999
Neuroblastoma	Associate	19216736, 20072950, 20233711
Neutropenia	Associate	25340731
Non alcoholic Fatty Liver Disease	Associate	21878559, 23935829
Obesity	Associate	26792383, 28458315, 32183743
Optic Neuropathy Ischemic	Associate	22736676
Osteosarcoma	Associate	22870217, 26300407, 33509236
Ovarian Neoplasms	Associate	20019844, 22112610, 24124770, 25611552, 26136502, 28611294, 30526541, 30672151, 32169072, 32894980, 33635609, 35639349, 37990267, 40565261
Overweight	Stimulate	26462791
Overweight	Associate	32000861, 36967798
Pancreatic Neoplasms	Associate	20118824, 20628378, 20922799, 21487324, 25469510, 26785721, 29444383, 33200805
Peptic Ulcer	Associate	26578453
Peripheral Nervous System Diseases	Associate	24351404
Photosensitivity Disorders	Associate	34009629
Polycythemia Vera	Associate	33805426
Polyposis Syndrome Hereditary Mixed 1	Associate	25793771
Pre Eclampsia	Inhibit	25446997
Pre Eclampsia	Associate	31561453
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15521915, 27960630
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11703319, 20019844, 21679421, 38039756
Prodromal Symptoms	Stimulate	26178481
Prostatic Neoplasms	Associate	18056989, 18500686, 18710444, 22216200, 24990514, 28300564
Prostatic Neoplasms	Inhibit	26459268
Prostatic Neoplasms Castration Resistant	Associate	18710444
Prostatic Neoplasms Castration Resistant	Stimulate	21365123
Protoporphyria Erythropoietic	Associate	35414164
Pseudoxanthoma Elasticum	Associate	18936737
Psoriasis	Associate	34680995
Renal hypouricemia	Associate	32375679
Renal Insufficiency Chronic	Associate	23665398, 30181573
Retinal Dysplasia	Associate	25793771, 26178481
Retinoblastoma	Associate	16556617, 20157412, 27247490
Sarcoma	Associate	27314299
Sarcoma	Inhibit	34030451
Sarcoma Synovial	Associate	23047249
Schizophrenia	Associate	30214039
Sjogren's Syndrome	Associate	21655359
Small Cell Lung Carcinoma	Associate	19036469, 21455636
Squamous Cell Carcinoma of Head and Neck	Associate	23992541, 24415717, 25275603, 37038789
Stomach Neoplasms	Associate	11513878, 12946267, 24151392, 25727099, 26774363, 28029654, 28847472, 28852730, 31364115, 36522839, 37621132
Stomatitis	Associate	34614057
Stroke	Associate	19023099
T Lymphocytopenia Idiopathic CD4 Positive	Associate	40203631
Testicular Germ Cell Tumor	Associate	39258697
Thrombocytopenia	Associate	25340731, 26914831
Thyroid Neoplasms	Associate	37919637
Triple Negative Breast Neoplasms	Associate	25140317, 37147730, 38019248
Tuberculosis Multidrug Resistant	Associate	18382425, 19479068, 19582433, 19584229, 19635183, 21520403, 21712253, 22113078, 22348324, 22938493, 23988382, 24032744, 24726739, 24736530, 24939447 View all (25 more)
Tuberculosis Multidrug Resistant	Stimulate	22870247, 28597653, 34502348, 39388999, 40158757
Tuberculosis Multidrug Resistant	Inhibit	26799285
Tuberous Sclerosis 1	Stimulate	22870217
Urinary Bladder Neoplasms	Associate	29397866
Uterine Cervical Dysplasia	Associate	26178481, 35379200
Uveal melanoma	Associate	22815634
Virus Diseases	Inhibit	31561453
Virus Diseases	Associate	33427563
Weight Gain	Associate	33625064
Xerostomia	Associate	36982571

ABCG2 (ATP binding cassette subfamily G member 2 (JR blood group))