ZBTB16 (zinc finger and BTB domain containing 16)

Gene

• Entrez ID: 7704
• Gene name: Zinc finger and BTB domain containing 16
• Gene symbol: ZBTB16
• Synonyms: PLZF, ZNF145
• Chromosome: 11
• Chromosome location: 11q23.2
• Summary: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434606	A>G	Pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT520001	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT520001	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT520001	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT520002	hsa-miR-6083	PAR-CLIP	23446348
MIRT520002	hsa-miR-6083	HITS-CLIP	23313552
MIRT520003	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT520003	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT520003	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT520004	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520004	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT520004	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT564828	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT564829	hsa-miR-3145-3p	PAR-CLIP	20371350
MIRT564830	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT564831	hsa-miR-5685	PAR-CLIP	20371350
MIRT564832	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT564833	hsa-miR-4690-3p	PAR-CLIP	20371350
MIRT564834	hsa-miR-3908	PAR-CLIP	20371350
MIRT564835	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT564836	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564837	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564838	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564839	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564840	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564841	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564842	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT651384	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT651385	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651386	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT651387	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT651388	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT651389	hsa-miR-4284	HITS-CLIP	23824327
MIRT651390	hsa-miR-1976	HITS-CLIP	23824327
MIRT651391	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT651392	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT651393	hsa-miR-4287	HITS-CLIP	23824327
MIRT651394	hsa-miR-4469	HITS-CLIP	23824327
MIRT651395	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651396	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651397	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651398	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651399	hsa-miR-5193	HITS-CLIP	23824327
MIRT651400	hsa-miR-1470	HITS-CLIP	23824327
MIRT651401	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT651402	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT707766	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT718186	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT718187	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT718188	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT718189	hsa-miR-6849-3p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12802276
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12802276
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12802276
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	21873635
GO:0001823	Process	Mesonephros development	ISS	8541544
GO:0003677	Function	DNA binding	IDA	12802276
GO:0003677	Function	DNA binding	NAS	9294197
GO:0005515	Function	Protein binding	IPI	9294197, 10980608, 16169070, 16189514, 16676348, 16828757, 17118363, 17500595, 19648967, 21988832, 23088713, 24359566, 25241761, 25416956, 26871637, 27107012, 29997244, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	9294197, 11929873, 21547890, 24359566
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006915	Process	Apoptotic process	NAS	9294197
GO:0007417	Process	Central nervous system development	ISS	8541544
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IDA	19648967, 24359566
GO:0016605	Component	PML body	IDA	9294197
GO:0016607	Component	Nuclear speck	IDA	8541544
GO:0017053	Component	Transcription repressor complex	IDA	12802276
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030097	Process	Hemopoiesis	IDA	8541544
GO:0030097	Process	Hemopoiesis	TAS	9294197
GO:0030099	Process	Myeloid cell differentiation	TAS	9294197
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IMP	21547890
GO:0032991	Component	Protein-containing complex	IMP	10980608
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0035136	Process	Forelimb morphogenesis	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IPI	9294197, 25416956, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	8622986
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	21547890
GO:0045638	Process	Negative regulation of myeloid cell differentiation	ISS	8541544
GO:0045778	Process	Positive regulation of ossification	IDA	21547890
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	12802276, 24359566
GO:0045892	Process	Negative regulation of transcription, DNA-templated	NAS	9294197
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	21547890
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048133	Process	Male germ-line stem cell asymmetric division	IEA
GO:0051138	Process	Positive regulation of NK T cell differentiation	IEA
GO:0051216	Process	Cartilage development	IDA	21547890
GO:0061036	Process	Positive regulation of cartilage development	IDA	21547890

Other IDs

• MIM: 176797
• HGNC: 12930
• e!Ensembl: ENSG00000109906

Protein

• UniProt ID: Q05516
• Protein name: Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)
• Protein function: Acts as a transcriptional repressor (PubMed:10688654, PubMed:24359566). Transcriptional repression may be mediated through recruitment of histone deacetylases to target promoters (PubMed:10688654). May play a role in myeloid maturation and in the development and/or maintenance of other differentiated tissues. Probable substrate-recognition component of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:14528312).
• PDB: 1BUO, 1CS3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00651	BTB	24 → 126	BTB/POZ domain	Domain
  PF13912	zf-C2H2_6	460 → 485		Domain
  PF00096	zf-C2H2	491 → 512	Zinc finger, C2H2 type	Domain
  PF13912	zf-C2H2_6	517 → 542		Domain
  PF00096	zf-C2H2	546 → 568	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	574 → 596	Zinc finger, C2H2 type	Domain

• Sequence:

  MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
  ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
  MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
  VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
  VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
  ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
  ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
  QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
  QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
  TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
  PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
  WRIEKTYLYLCYV

• Sequence length: 673