GediPNet logo

WASF2 (WASP family member 2)
Gene
Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10163
Gene nameGene Name - the full gene name approved by the HGNC.
WASP family member 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
WASF2
SynonymsGene synonyms aliases
IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs Transcription factors Other IDs
miRTarBase ID miRNA Experiments Reference
MIRT007243 hsa-miR-146a-5p Luciferase reporter assay 23435376
MIRT007243 hsa-miR-146a-5p Immunohistochemistry, qRT-PCR, Western blot 28387985
MIRT022583 hsa-miR-124-3p Microarray 18668037
MIRT023756 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT025275 hsa-miR-34a-5p Proteomics 21566225
Transcription factors
Gene SNPs Transcription factors Other IDs
Transcription factor Regulation Reference
FOXF2 Activation 19562724
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Transcription factors Other IDs
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001667 Process Ameboidal-type cell migration IEA
GO:0001726 Component Ruffle IEA
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 11130076, 16417406, 16483316, 18560548, 24705354, 32814053
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Transcription factors Other IDs
MIM
HGNC
e!Ensembl
Protein
Gene SNPs Transcription factors Other IDs
UniProt ID Q9Y6W5
Protein name Wiskott-Aldrich syndrome protein family member 2 (WASP family protein member 2) (Protein WAVE-2) (Verprolin homology domain-containing protein 2)
Protein function Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
PDB 2A40
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02205 WH2
433 → 460
WH2 motif
 Family
Sequence 
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
Sequence length 498
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412