VEGFC (vascular endothelial growth factor C)

Gene

• Entrez ID: 7424
• Gene name: Vascular endothelial growth factor C
• Gene symbol: VEGFC
• Synonyms: Flt4-L, LMPH1D, LMPHM4, VRP
• Chromosome: 4
• Chromosome location: 4q34.3
• Summary: The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors. [provided by RefSeq, Apr 2014]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777566	->AA	Pathogenic	Frameshift variant, coding sequence variant
rs587777567	G>A	Pathogenic	Stop gained, coding sequence variant
rs1057524647	T>A	Pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006603	hsa-miR-1826	Luciferase reporter assay, Western blot	22049531
MIRT021989	hsa-miR-128-3p	Microarray	17612493
MIRT021989	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	25001183
MIRT021989	hsa-miR-128-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT054253	hsa-miR-27b-3p	ELISA, Immunofluorescence, Microarray, Luciferase reporter assay, QRTPCR, Western blot	23593282
MIRT054253	hsa-miR-27b-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT439305	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT531419	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT531420	hsa-miR-3185	PAR-CLIP	22012620
MIRT531421	hsa-miR-3200-5p	PAR-CLIP	22012620
MIRT531421	hsa-miR-3200-5p	HITS-CLIP	23824327
MIRT531422	hsa-miR-4678	PAR-CLIP	22012620
MIRT531423	hsa-miR-577	PAR-CLIP	22012620
MIRT531424	hsa-miR-548m	PAR-CLIP	22012620
MIRT631899	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT631900	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631901	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT631902	hsa-miR-6860	HITS-CLIP	23824327
MIRT631903	hsa-miR-661	HITS-CLIP	23824327
MIRT631904	hsa-miR-612	HITS-CLIP	23824327
MIRT631905	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT631906	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT631907	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT631908	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT631909	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT631910	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631911	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT631912	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT675479	hsa-miR-7703	HITS-CLIP	23824327
MIRT675480	hsa-miR-4252	HITS-CLIP	23824327
MIRT675481	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT675482	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT732064	hsa-miR-101-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26299768
MIRT735476	hsa-miR-122-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	27508026

Transcription factors

Transcription factor	Regulation	Reference
RUNX2	Activation	22641097
SIX1	Activation	22466647

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IBA	21873635
GO:0002040	Process	Sprouting angiogenesis	IBA	21873635
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002576	Process	Platelet degranulation	TAS
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	20145116, 21130043, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006929	Process	Substrate-dependent cell migration	TAS	8617204
GO:0007165	Process	Signal transduction	TAS	8617204
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8617204
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016331	Process	Morphogenesis of embryonic epithelium	IEA
GO:0030947	Process	Regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031954	Process	Positive regulation of protein autophosphorylation	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IDA	19275959
GO:0042493	Process	Response to drug	IEA
GO:0043185	Function	Vascular endothelial growth factor receptor 3 binding	IBA	21873635
GO:0043185	Function	Vascular endothelial growth factor receptor 3 binding	IPI	23878260
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IBA	21873635
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA	21873635
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	23878260
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA	21873635
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA	21873635
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:1901492	Process	Positive regulation of lymphangiogenesis	IEA
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 601528
• HGNC: 12682
• e!Ensembl: ENSG00000150630

Protein

• UniProt ID: P49767
• Protein name: Vascular endothelial growth factor C (VEGF-C) (Flt4 ligand) (Flt4-L) (Vascular endothelial growth factor-related protein) (VRP)
• Protein function: Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.
• PDB: 2X1W, 2X1X, 4BSK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	131 → 211	PDGF/VEGF domain	Domain
  PF03128	CXCXC	283 → 295	CXCXC repeat	Repeat
  PF03128	CXCXC	308 → 319	CXCXC repeat	Repeat
  PF03128	CXCXC	331 → 343	CXCXC repeat	Repeat

• Sequence:

  MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
  RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
  SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
  LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN
  KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
  PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
  ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

• Sequence length: 419