VEGFB (vascular endothelial growth factor B)

Gene

• Entrez ID: 7423
• Gene name: Vascular endothelial growth factor B
• Gene symbol: VEGFB
• Synonyms: VEGFL, VRF
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Sep 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT651734	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT651735	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT651736	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT651737	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT651738	hsa-miR-4448	HITS-CLIP	23824327
MIRT651739	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651740	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT651741	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT651742	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT651743	hsa-miR-4692	HITS-CLIP	23824327
MIRT651744	hsa-miR-4514	HITS-CLIP	23824327
MIRT651745	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT651746	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT651747	hsa-miR-940	HITS-CLIP	23824327
MIRT651748	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT651749	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT651750	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT651751	hsa-miR-361-5p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
FOXM1	Unknown	21860419
FOXO3	Unknown	21860419
HDGF	Activation	14662017
HIF1A	Unknown	21731766
STAT3	Unknown	16899623;21731766
WT1	Unknown	17127464
YY1	Activation	20660740

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IBA	21873635
GO:0002040	Process	Sprouting angiogenesis	IBA	21873635
GO:0002576	Process	Platelet degranulation	TAS
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	19483306, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008201	Function	Heparin binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IBA	21873635
GO:0042493	Process	Response to drug	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IBA	21873635
GO:0045766	Process	Positive regulation of angiogenesis	IBA	21873635
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA	21873635
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA	21873635
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA	21873635
GO:0060976	Process	Coronary vasculature development	IEA

Other IDs

• MIM: 601398
• HGNC: 12681
• e!Ensembl: ENSG00000173511

Protein

• UniProt ID: P49765
• Protein name: Vascular endothelial growth factor B (VEGF-B) (VEGF-related factor) (VRF)
• Protein function: Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
• PDB: 2C7W, 2VWE, 2XAC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	47 → 124	PDGF/VEGF domain	Domain

• Sequence:

  MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
  MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
  QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
  STTSALTPGPAAAAADAAASSVAKGGA

• Sequence length: 207