GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

VEGFA (vascular endothelial growth factor A)

Gene

7422

Vascular endothelial growth factor A

VEGFA

MVCD1, VEGF, VPF

6p21.1

This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. The levels of VEGF are increased during infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), thus promoting inflammation by facilitating recruitment of inflammatory cells, and by increasing the level of angiopoietin II (Ang II), one of two products of the SARS-CoV-2 binding target, angiotensin-converting enzyme 2 (ACE2). In turn, Ang II facilitates the elevation of VEGF, thus forming a vicious cycle in the release of inflammatory cytokines. [provided by RefSeq, Jun 2020]

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2010963	C>G,T	Risk-factor	Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs756155710	GACA>-,GACAGACA,GACAGACAGACA	Likely-pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant, upstream transcript variant, genic upstream transcript variant

Show/Hide all(299)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000721	hsa-miR-373-3p	ELISA, Luciferase reporter assay	18320040
MIRT000722	hsa-miR-302d-3p	ELISA, Luciferase reporter assay	18320040
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, Reporter assay	19223090
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, Western blot, Reporter assay;Western blot	21249429
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	25428912
MIRT003428	hsa-miR-126-3p	PAR-CLIP	21572407
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	24140635
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23900443
MIRT003810	hsa-miR-147a	ELISA, Luciferase reporter assay	18320040
MIRT003811	hsa-miR-134-5p	ELISA, Luciferase reporter assay	18320040
MIRT003812	hsa-miR-140-5p	ELISA, Luciferase reporter assay	18320040
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26402430
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003813	hsa-miR-29b-3p	ELISA, Luciferase reporter assay	18320040
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003813	hsa-miR-29b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28222438
MIRT003814	hsa-miR-107	ELISA, Luciferase reporter assay	18320040
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Reporter assay	15131085
MIRT003890	hsa-miR-16-5p	ELISA, Luciferase reporter assay	18320040
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	21885851
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23083510
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT003890	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT003890	hsa-miR-16-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004055	hsa-miR-93-5p	ELISA, Luciferase reporter assay	18320040
MIRT004055	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	26175939
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004272	hsa-miR-150-5p	ELISA, Luciferase reporter assay	18320040
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	18320040
MIRT004273	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT004273	hsa-miR-195-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay	23468064
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT004274	hsa-miR-15b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT004274	hsa-miR-15b-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay	23233752
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT004275	hsa-miR-15a-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	Chromatin immunoprecipitation, Immunoblot, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR	27322147
MIRT004275	hsa-miR-15a-5p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27916780
MIRT004276	hsa-miR-520g-3p	ELISA, Luciferase reporter assay	18320040
MIRT004277	hsa-miR-378a-3p	ELISA, Luciferase reporter assay	18320040
MIRT004277	hsa-miR-378a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23333942
MIRT004278	hsa-miR-330-3p	ELISA, Luciferase reporter assay	18320040
MIRT004443	hsa-miR-383-5p	ELISA, Luciferase reporter assay	18320040
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26398444
MIRT004447	hsa-miR-361-5p	ELISA, Luciferase reporter assay	18320040
MIRT004447	hsa-miR-361-5p	qRT-PCR, Western blot	23128854
MIRT004447	hsa-miR-361-5p	ELISA, Luciferase reporter assay, qRT-PCR	23166713
MIRT004447	hsa-miR-361-5p	Luciferase reporter assay, Western blot	27641667
MIRT004450	hsa-miR-20a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004451	hsa-miR-20b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004451	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26612965
MIRT004457	hsa-miR-504-5p	ELISA, Luciferase reporter assay	18320040
MIRT004458	hsa-miR-520h	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004465	hsa-miR-106a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004465	hsa-miR-106a-5p	Microarray	23807165
MIRT004466	hsa-miR-106b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004466	hsa-miR-106b-5p	Microarray	17242205
MIRT004513	hsa-miR-34a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004518	hsa-miR-205-5p	ELISA, Luciferase reporter assay	18320040
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay, Reporter assay	19238171
MIRT004518	hsa-miR-205-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22159356
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	25172656
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	26396534
MIRT004519	hsa-miR-34b-3p	ELISA, Luciferase reporter assay	18320040
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006215	hsa-miR-145-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR	22592534
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blotting	24886719
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay	28122882
MIRT006440	hsa-miR-200b-3p	qRT-PCR, Western blot	25884496
MIRT006771	hsa-miR-200c-3p	Luciferase reporter assay	22685266
MIRT006771	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT007224	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT007224	hsa-miR-503-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT016911	hsa-miR-335-5p	Microarray	18185580
MIRT020389	hsa-miR-29c-3p	Sequencing, PAR-CLIP	20371350
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT021401	hsa-miR-9-5p	qRT-PCR;Other	20173740
MIRT021711	hsa-miR-133a-3p	Reporter assay	21249429
MIRT027248	hsa-miR-101-3p	Sequencing	20371350
MIRT027248	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR	23608225
MIRT027248	hsa-miR-101-3p	Luciferase reporter assay	25658842
MIRT030717	hsa-miR-21-5p	qRT-PCR	19435867
MIRT030717	hsa-miR-21-5p	Western blot;qRT-PCR	21544242
MIRT053074	hsa-miR-203a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23867971
MIRT053585	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24209632
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT053585	hsa-miR-29a-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT100741	hsa-miR-424-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT100742	hsa-miR-497-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	24398324
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	22012620
MIRT100743	hsa-miR-598-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	22012620
MIRT100744	hsa-miR-374b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	24398324
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	22012620
MIRT100745	hsa-miR-3163	PAR-CLIP, HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	24398324
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	22012620
MIRT100747	hsa-miR-451b	PAR-CLIP, HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT100749	hsa-miR-6838-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100755	hsa-miR-568	PAR-CLIP	23446348
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT100756	hsa-miR-1277-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	24398324
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	22012620
MIRT122988	hsa-miR-423-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT169147	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT169150	hsa-miR-299-3p	PAR-CLIP	23446348
MIRT169172	hsa-miR-297	PAR-CLIP	23446348
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169196	hsa-miR-3924	PAR-CLIP	23446348
MIRT169215	hsa-miR-6748-5p	PAR-CLIP	23446348
MIRT169216	hsa-miR-6756-5p	PAR-CLIP	23446348
MIRT169217	hsa-miR-6759-5p	PAR-CLIP	23446348
MIRT169218	hsa-miR-6766-5p	PAR-CLIP	23446348
MIRT169219	hsa-miR-6769a-5p	PAR-CLIP	23446348
MIRT169225	hsa-miR-6769b-5p	PAR-CLIP	23446348
MIRT317921	hsa-miR-95-5p	PAR-CLIP	23592263
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT317923	hsa-miR-3646	PAR-CLIP	23592263
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	20371350
MIRT317924	hsa-miR-5682	PAR-CLIP	23592263
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	20371350
MIRT360955	hsa-miR-185-5p	Luciferase reporter assay, Western blot	25448984
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26783726
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	20371350
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT464231	hsa-miR-5688	PAR-CLIP	23592263
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	20371350
MIRT464232	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT464233	hsa-miR-5692a	PAR-CLIP	23592263
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	24398324
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	22012620
MIRT464234	hsa-miR-646	PAR-CLIP, HITS-CLIP	21572407
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	24398324
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	22012620
MIRT464235	hsa-miR-3662	PAR-CLIP, HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT520223	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520224	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT520225	hsa-miR-6793-5p	PAR-CLIP	23446348
MIRT520226	hsa-miR-567	PAR-CLIP	23446348
MIRT520227	hsa-miR-4483	PAR-CLIP	23446348
MIRT520228	hsa-miR-1293	PAR-CLIP	23446348
MIRT520229	hsa-miR-6745	PAR-CLIP	23446348
MIRT520230	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT520231	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT520232	hsa-miR-5692c	PAR-CLIP	23446348
MIRT520233	hsa-miR-5692b	PAR-CLIP	23446348
MIRT520234	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT552961	hsa-miR-4789-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT552962	hsa-miR-3941	PAR-CLIP, HITS-CLIP	21572407
MIRT552963	hsa-miR-4719	PAR-CLIP, HITS-CLIP	21572407
MIRT552964	hsa-miR-603	PAR-CLIP, HITS-CLIP	21572407
MIRT552965	hsa-miR-362-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT552966	hsa-miR-329-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT552967	hsa-miR-8485	PAR-CLIP, HITS-CLIP	21572407
MIRT552968	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT552969	hsa-miR-4263	PAR-CLIP	21572407
MIRT552970	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT651752	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT651753	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT651754	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT651755	hsa-miR-5193	HITS-CLIP	23824327
MIRT651756	hsa-miR-5694	HITS-CLIP	23824327
MIRT707039	hsa-miR-4497	HITS-CLIP	21572407
MIRT731842	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27777493
MIRT731842	hsa-miR-1-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28493075
MIRT731842	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT732343	hsa-miR-125a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26398444
MIRT732583	hsa-miR-320a	Western blot	26837315
MIRT732702	hsa-miR-126-5p	Luciferase reporter assay	27146208
MIRT732809	hsa-miR-186-5p	Chromatin immunoprecipitation, Immunoblot, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR	27322147
MIRT733585	hsa-miR-205-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	27362808
MIRT733700	hsa-miR-1-5p	Luciferase reporter assay, Western blot	27819721
MIRT733964	hsa-miR-101-5p	Luciferase reporter assay, qRT-PCR, Western blot	26870229
MIRT734100	hsa-miR-181a-5p	Microarray, qRT-PCR, enzyme-linked immunosorbent assay	25106798
MIRT734268	hsa-miR-942-3p	qRT-PCR, Western blot	24475095
MIRT734599	hsa-miR-206	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT734906	hsa-miR-296-5p	qRT-PCR, Western blot	26500043
MIRT735197	hsa-miR-199a-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28358369
MIRT735400	hsa-miR-16-1-3p	qRT-PCR, Western blot	27596960
MIRT735515	hsa-miR-429	Luciferase reporter assay	26647818
MIRT740050	hsa-miR-3126-5p	PAR-CLIP	26701625
MIRT758089	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT758125	hsa-miR-6875-5p	PAR-CLIP	26701625

Transcription factors

Show/Hide all(81)

Transcription factor	Regulation	Reference
AR	Activation	16007189
AR	Unknown	23369005
ARNT	Unknown	16774940;19020709
ATF4	Activation	15788408;18829529
ATF4	Unknown	18451308;22915762;23908598
ATM	Repression	20676049
BRCA1	Activation	16543242
COPS5	Activation	12542982
DNMT1	Activation	17934516
E2F1	Repression	20639906
E2F3	Unknown	21372519
EGR1	Activation	20489156
EGR1	Repression	15517885
EGR1	Unknown	9049304
EP300	Activation	22789427
EPAS1	Activation	11301389;11751212;16900513;19080330
EPAS1	Unknown	15156561;16920734
ESR1	Activation	19398483
ESR1	Unknown	10995484;14647449
ESR2	Unknown	10995484
FOXM1	Unknown	21860419
FOXO3	Unknown	21860419
FOXQ1	Activation	20145154
HDAC2	Unknown	23926105
HDAC3	Unknown	23926105
HDAC4	Repression	19509297
HDGF	Activation	14662017;21302807
HEXIM1	Unknown	20453883
HIC1	Repression	24067369
HIF1A	Activation	11749701;12542982;12820439;15315159;15735682;15890092;16052307;16515634;16540671;16854277;16900513;17461470;17557905;17889387;18027712;18060642;18572865;19759417;22789427
HIF1A	Repression	12509854;14712484;15930297;16596228;18471962
HIF1A	Unknown	11486006;15156561;16543242;16774940;17486380;18835464;19238077;19502554;21731766;23060442
HIPK2	Repression	18644116;19046997
HNF1A	Unknown	21731766
HOXB7	Activation	21183939
HTATIP2	Repression	19349353
ID3	Unknown	16926250
JUN	Repression	11731421
KLF4	Unknown	23926105
MEF2C	Unknown	18450586
MYC	Activation	19398483
MYC	Unknown	18809243
NFKB1	Activation	15856023;16684540;17407600;18056465
NFKB1	Repression	15517885
NFKB1	Unknown	12160329;17673602;18184402;20103608;20538607
NKX3-1	Unknown	18974119
NR1H4	Activation	21364590
PGR	Unknown	22542550
PTTG1	Activation	12213878;16926250
RB1	Activation	16007189
RELA	Activation	15856023;16684540;17407600;18056465
RELA	Repression	15517885
RELA	Unknown	12160329;17673602;18184402;20103608;20538607
RUNX1	Repression	21447743
RUNX2	Activation	19509297;22641097
SMAD3	Unknown	11486006
SP1	Activation	10581162;12429844;15217947;15342781;16540671;16982770;21115498
SP1	Repression	11559575
SP1	Unknown	10816575;11731421;12560084;14647449;18575762;23369005;8910439
SP3	Unknown	10816575;14647449
STAT3	Unknown	23104276
STAT3	Activation	11960372;15735682;17169602;17533737;19284568;19880237;21278793;21418908
STAT3	Repression	17533737;19880237;22313388
STAT3	Unknown	12824281;16540670;16899623;17937859;18184402;18320073;19020709;20043094;21172343;21344490;21731766;25101566
TCF4	Activation	15940626
TEAD4	Repression	22761647
TFAP2A	Activation	9049304
TFAP2A	Unknown	11731421
TP53	Activation	16684540
TP53	Repression	11559575
TRAF6	Repression	22326918
UHRF1	Unknown	17934516
VHL	Activation	10804089;7533661;8625303
VHL	Repression	10581162;12539169;12912922;8855222;9370235
VHL	Unknown	10189987;19801654;9572397;9689663
WT1	Activation	20871039
WT1	Unknown	16572586;17127464
XBP1	Unknown	20824063
ZFP36	Repression	21507959;21656745
ZFP36L1	Repression	19801654
ZNF24	Repression	20510677;23212515

Show/Hide all(160)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18093989
GO:0001525	Process	Angiogenesis	IDA	11427521, 21771332
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IMP	23083510, 23688497
GO:0001569	Process	Branching involved in blood vessel morphogenesis	ISS
GO:0001570	Process	Vasculogenesis	TAS	15015550
GO:0001666	Process	Response to hypoxia	IBA	21873635
GO:0001666	Process	Response to hypoxia	IDA	16490744
GO:0001701	Process	In utero embryonic development	ISS
GO:0001822	Process	Kidney development	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18386220, 19033661
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IBA	21873635
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	9202027, 10022831, 12714610, 16489009, 18386220, 18577655, 20497126
GO:0001938	Process	Positive regulation of endothelial cell proliferation	ISS
GO:0001968	Function	Fibronectin binding	IDA	14570917
GO:0002040	Process	Sprouting angiogenesis	IBA	21873635
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	18059339, 20660291
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IDA	20660291
GO:0002576	Process	Platelet degranulation	TAS
GO:0002687	Process	Positive regulation of leukocyte migration	TAS	1312256
GO:0003007	Process	Heart morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003169	Process	Coronary vein morphogenesis	ISS
GO:0005125	Function	Cytokine activity	IDA	18440775
GO:0005125	Function	Cytokine activity	ISS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	17470632
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA	21873635
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IPI	10471394, 11513746
GO:0005515	Function	Protein binding	IPI	9393862, 10543948, 16763549, 17222790, 20660291, 22020326, 23374253, 23583373, 25825981
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	9202027, 16490744
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IDA	17082651
GO:0005912	Component	Adherens junction	IDA	26598555
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS
GO:0007399	Process	Nervous system development	TAS	15351965
GO:0007498	Process	Mesoderm development	ISS
GO:0007595	Process	Lactation	ISS
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008083	Function	Growth factor activity	IDA	9202027, 20497126
GO:0008083	Function	Growth factor activity	ISS
GO:0008201	Function	Heparin binding	IDA	15001987
GO:0008201	Function	Heparin binding	IMP	14570917
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7929439
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26268439
GO:0008360	Process	Regulation of cell shape	IDA	7929439, 10527820
GO:0009986	Component	Cell surface	IDA	17470632
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	10022831, 19033661
GO:0010628	Process	Positive regulation of gene expression	IDA	18386220
GO:0010629	Process	Negative regulation of gene expression	IDA	28977001
GO:0010629	Process	Negative regulation of gene expression	IMP	19148554
GO:0010749	Process	Regulation of nitric oxide mediated signal transduction	IDA	16150726
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030141	Component	Secretory granule	IDA	17082651
GO:0030224	Process	Monocyte differentiation	IDA	21149635
GO:0030225	Process	Macrophage differentiation	IDA	21149635
GO:0030324	Process	Lung development	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	7929439, 17470632
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0031012	Component	Extracellular matrix	NAS	14570917
GO:0031077	Process	Post-embryonic camera-type eye development	ISS
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	16489009, 19033661
GO:0031954	Process	Positive regulation of protein autophosphorylation	IDA	20497126
GO:0032147	Process	Activation of protein kinase activity	IDA	18059339, 20497126
GO:0032793	Process	Positive regulation of CREB transcription factor activity	IDA	20497126
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	18440775, 20497126
GO:0035148	Process	Tube formation	IDA	19033661
GO:0035767	Process	Endothelial cell chemotaxis	IDA	18440775
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	18440775, 20497126
GO:0036303	Process	Lymph vessel morphogenesis	ISS
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	IMP	23688497
GO:0038033	Process	Positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IDA	18440775, 20497126, 21245381
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA	21873635
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IMP	23083510
GO:0038091	Process	Positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway	IDA	17470632
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	ISS
GO:0042056	Function	Chemoattractant activity	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IDA	17082651, 18059339, 18440775, 20497126, 21245381
GO:0042462	Process	Eye photoreceptor cell development	ISS
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	19390056
GO:0042802	Function	Identical protein binding	IPI	12207021, 25132001
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10066377, 11461089
GO:0043117	Process	Positive regulation of vascular permeability	IDA	26598555
GO:0043129	Process	Surfactant homeostasis	ISS
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	18386220
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IBA	21873635
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IPI	1312256
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IBA	21873635
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	1417831, 10022831, 20660291, 25825981
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	18440775
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	9202027, 18440775, 20497126
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	23688497
GO:0045766	Process	Positive regulation of angiogenesis	IBA	21873635
GO:0045766	Process	Positive regulation of angiogenesis	IDA	18440775, 18577655, 19033661, 20497126
GO:0045766	Process	Positive regulation of angiogenesis	IMP	18275976
GO:0045785	Process	Positive regulation of cell adhesion	IDA	19674970
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18059339
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18093989
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA	21873635
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	1312256, 7929439, 21245381
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048018	Function	Receptor ligand activity	IMP	23083510
GO:0048018	Function	Receptor ligand activity	IPI	20660291
GO:0048469	Process	Cell maturation	ISS
GO:0048593	Process	Camera-type eye morphogenesis	ISS
GO:0048739	Process	Cardiac muscle fiber development	ISS
GO:0048754	Process	Branching morphogenesis of an epithelial tube	ISS
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	ISS
GO:0048844	Process	Artery morphogenesis	ISS
GO:0050679	Process	Positive regulation of epithelial cell proliferation	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10022831, 16489009, 20048167, 21245381, 26598555
GO:0050840	Function	Extracellular matrix binding	IC	14570917
GO:0050918	Process	Positive chemotaxis	IDA	20497126
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	7929439, 12744932
GO:0050930	Process	Induction of positive chemotaxis	IBA	21873635
GO:0050930	Process	Induction of positive chemotaxis	NAS	12744932
GO:0051272	Process	Positive regulation of cellular component movement	IDA	10527820, 12744932
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	16489009
GO:0060319	Process	Primitive erythrocyte differentiation	ISS
GO:0060749	Process	Mammary gland alveolus development	ISS
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA	21873635
GO:0060948	Process	Cardiac vascular smooth muscle cell development	ISS
GO:0060982	Process	Coronary artery morphogenesis	ISS
GO:0061042	Process	Vascular wound healing	IMP	23688497
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0061419	Process	Positive regulation of transcription from RNA polymerase II promoter in response to hypoxia	IMP	19652095
GO:0071456	Process	Cellular response to hypoxia	IDA	10575000
GO:0071542	Process	Dopaminergic neuron differentiation	ISS
GO:0071679	Process	Commissural neuron axon guidance	ISS
GO:0090037	Process	Positive regulation of protein kinase C signaling	IDA	18059339
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IDA	20551324
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IGI	24844779
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	23083510, 24865854
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:0090259	Process	Regulation of retinal ganglion cell axon guidance	ISS
GO:0097475	Process	Motor neuron migration	ISS
GO:0097533	Process	Cellular stress response to acid chemical	IDA	26299712
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26683794
GO:1900086	Process	Positive regulation of peptidyl-tyrosine autophosphorylation	IDA	20660291
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	18386220
GO:1901165	Process	Positive regulation of trophoblast cell migration	IMP	23083510
GO:1901727	Process	Positive regulation of histone deacetylase activity	IDA	20497126
GO:1902336	Process	Positive regulation of retinal ganglion cell axon guidance	ISS
GO:1903141	Process	Negative regulation of establishment of endothelial barrier	IDA	20048167
GO:1903392	Process	Negative regulation of adherens junction organization	IDA	26598555
GO:1903572	Process	Positive regulation of protein kinase D signaling	IDA	20497126
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	24844779
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	30106099
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	26299712
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IGI	25251394
GO:1905604	Process	Negative regulation of blood-brain barrier permeability	IMP	19148554
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	26598555

MIM	HGNC	e!Ensembl
192240	12680	ENSG00000112715

Protein

UniProt ID

P15692

Protein name

Vascular endothelial growth factor A (VEGF-A) (Vascular permeability factor) (VPF)

Protein function

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).

PDB

1BJ1 , 1CZ8 , 1FLT , 1KAT , 1KMX , 1MJV , 1MKG , 1MKK , 1QTY , 1TZH , 1TZI , 1VGH , 1VPF , 1VPP , 2FJG , 2FJH , 2QR0 , 2VGH , 2VPF , 3BDY , 3P9W , 3QTK , 3S1B , 3S1K , 3V2A , 4DEQ , 4GLN , 4GLS , 4KZN , 4QAF , 4WPB , 4ZFF , 5DN2 , 5FV1 , 5FV2 , 5HHC , 5HHD , 5O4E , 5T89 , 6BFT , 6D3O , 6T9D , 6V7K , 7LL8 , 7LL9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00341	PDGF	52 → 130	PDGF/VEGF domain	Domain
PF14554	VEGF_C	180 → 232	VEGF heparin-binding domain	Domain

Sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Sequence length

232

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412