UBA52 (ubiquitin A-52 residue ribosomal protein fusion product 1)

Gene

• Entrez ID: 7311
• Gene name: Ubiquitin A-52 residue ribosomal protein fusion product 1
• Gene symbol: UBA52
• Synonyms: CEP52, HUBCEP52, L40, RPL40
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT036240	hsa-miR-320b	CLASH	23622248
MIRT039613	hsa-miR-615-3p	CLASH	23622248
MIRT041941	hsa-miR-484	CLASH	23622248
MIRT043902	hsa-miR-378a-3p	CLASH	23622248
MIRT044819	hsa-miR-320a	CLASH	23622248
MIRT045345	hsa-miR-185-5p	CLASH	23622248
MIRT051853	hsa-let-7c-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000717	Process	Nucleotide-excision repair, DNA duplex unwinding	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	15147878, 15231748, 15936278, 21900206, 32296183, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006294	Process	Nucleotide-excision repair, preincision complex assembly	TAS
GO:0006296	Process	Nucleotide-excision repair, DNA incision, 5'-to lesion	TAS
GO:0006297	Process	Nucleotide-excision repair, DNA gap filling	TAS
GO:0006413	Process	Translational initiation	TAS
GO:0006464	Process	Cellular protein modification process	TAS
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	TAS
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007254	Process	JNK cascade	TAS
GO:0010008	Component	Endosome membrane	TAS
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0016197	Process	Endosomal transport	TAS
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019058	Process	Viral life cycle	TAS
GO:0019068	Process	Virion assembly	TAS
GO:0019083	Process	Viral transcription	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019941	Process	Modification-dependent protein catabolic process	IBA	21873635
GO:0019985	Process	Translesion synthesis	TAS
GO:0022627	Component	Cytosolic small ribosomal subunit	IBA	21873635
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031386	Function	Protein tag	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031982	Component	Vesicle	HDA	19190083
GO:0033683	Process	Nucleotide-excision repair, DNA incision	TAS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0036297	Process	Interstrand cross-link repair	TAS
GO:0042276	Process	Error-prone translesion synthesis	TAS
GO:0042769	Process	DNA damage response, detection of DNA damage	TAS
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043657	Component	Host cell	IEA
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0051403	Process	Stress-activated MAPK cascade	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0061024	Process	Membrane organization	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070911	Process	Global genome nucleotide-excision repair	TAS
GO:0070987	Process	Error-free translesion synthesis	TAS
GO:0075733	Process	Intracellular transport of virus	TAS

Other IDs

• MIM: 191321
• HGNC: 12458
• e!Ensembl: ENSG00000221983

Protein

• UniProt ID: P62987
• Protein name: Ubiquitin-60S ribosomal protein L40 (CEP52) (Ubiquitin A-52 residue ribosomal protein fusion product 1) [Cleaved into: Ubiquitin; 60S ribosomal protein L40 (Large ribosomal subunit protein eL40)]
• Protein function: [Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.; [60S ribosomal protein L40]: Component of the 60S subunit of the ribosome. Ribosomal protein L40 is essential for translation of a subset of cellular transcripts, and especially for cap-dependent translation of vesicular stomatitis virus mRNAs.
• PDB: 2LJ5, 2MBH, 2MJB, 2MUR, 2N3U, 2N3V, 2N3W, 2NBD, 2NBE, 2RSU, 4HJK, 4JIO, 4P4H, 4PIG, 4PIH, 4PIJ, 4RF0, 4RF1, 4S1Z, 4UG0, 4V6X, 4XKL, 5AJ0, 5GO7, 5GO8, 5GOB, 5GOC, 5GOD, 5GOG, 5GOH, 5GOI, 5GOJ, 5GOK, 5HPK, 5HPL, 5HPS, 5HPT, 5J26, 5J8P, 5JBV, 5JBY, 5LKS, 5T2C, 6EK0, 6IP5, 6IP6, 6IP8, 6LQM, 6OLE, 6OLF, 6OLG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
  PF01020	Ribosomal_L40e	78 → 127	Ribosomal L40e family	Family

• Sequence:

  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
  IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
  LRPKKKVK

• Sequence length: 128