TRADD (TNFRSF1A associated via death domain)

Gene

• Entrez ID: 8717
• Gene name: TNFRSF1A associated via death domain
• Gene symbol: TRADD
• Synonyms: Hs.89862
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT495112	hsa-miR-5704	PAR-CLIP	23708386
MIRT495113	hsa-miR-4480	PAR-CLIP	23708386
MIRT495114	hsa-miR-338-3p	PAR-CLIP	23708386
MIRT495115	hsa-miR-4530	PAR-CLIP	23708386
MIRT495116	hsa-miR-1295b-3p	PAR-CLIP	23708386
MIRT495117	hsa-miR-922	PAR-CLIP	23708386
MIRT495118	hsa-miR-15a-3p	PAR-CLIP	23708386
MIRT495119	hsa-miR-4717-5p	PAR-CLIP	23708386
MIRT734116	hsa-miR-30c-2-3p	Luciferase reporter assay, qRT-PCR, Western blot	25732226

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	IBA	21873635
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	IDA	23429285
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IBA	21873635
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IPI	8612133
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	1040062, 7758105, 8565075, 8943045, 8985253, 9020361, 10848577, 10892748, 11112409, 11374864, 11684708, 14743216, 16611992, 18198944, 19379743, 19524513, 19641494, 19781631, 20628368, 22510408, 23429285, 23955153, 24025841, 24130170, 30561431, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	11684708, 22510408
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	22510408
GO:0006915	Process	Apoptotic process	TAS	7758105
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0007165	Process	Signal transduction	TAS	7758105
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IEA
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	8612133
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0019900	Function	Kinase binding	IPI	8612133
GO:0030335	Process	Positive regulation of cell migration	IMP	25732226
GO:0031264	Component	Death-inducing signaling complex	TAS	18309324
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	8612133
GO:0042802	Function	Identical protein binding	IPI	7758105, 11684708, 30561431
GO:0043065	Process	Positive regulation of apoptotic process	TAS	18309324
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0043235	Component	Receptor complex	IDA	8612133
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	25732226
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	25732226
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS	18309324
GO:0051798	Process	Positive regulation of hair follicle development	IEA
GO:0070513	Function	Death domain binding	IPI	8612133
GO:0071356	Process	Cellular response to tumor necrosis factor	IMP	25732226
GO:0071550	Process	Death-inducing signaling complex assembly	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA	21873635
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	18309324
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IMP	25732226
GO:1902041	Process	Regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS

Other IDs

• MIM: 603500
• HGNC: 12030
• e!Ensembl: ENSG00000102871

Protein

• UniProt ID: Q15628
• Protein name: Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain)
• Protein function: Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD (PubMed:7758105, PubMed:8612133, PubMed:23955153). Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B (PubMed:7758105, PubMed:8612133). The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A (By similarity).
• PDB: 1F2H, 1F3V, 5XME, 6AC0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09034	TRADD_N	51 → 161	TRADD, N-terminal domain	Domain
  PF00531	Death	217 → 304	Death domain	Domain

• Sequence:

  MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
  MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
  GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
  QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
  CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
  LLGLTDPNGGLA

• Sequence length: 312