TNFRSF1B (TNF receptor superfamily member 1B)

Gene

• Entrez ID: 7133
• Gene name: TNF receptor superfamily member 1B
• Gene symbol: TNFRSF1B
• Synonyms: CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT129887	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT129893	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT129958	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT129959	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT717187	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT717188	hsa-miR-3909	HITS-CLIP	19536157
MIRT717189	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT717190	hsa-miR-6072	HITS-CLIP	19536157
MIRT717191	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717192	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT717193	hsa-miR-299-3p	HITS-CLIP	19536157
MIRT717194	hsa-miR-96-3p	HITS-CLIP	19536157

Transcription factors

Transcription factor	Regulation	Reference
JUN	Activation	9743209

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002718	Process	Regulation of cytokine production involved in immune response	ISS
GO:0002724	Process	Regulation of T cell cytokine production	IBA	21873635
GO:0002724	Process	Regulation of T cell cytokine production	ISS
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	TAS	24966471
GO:0003176	Process	Aortic valve development	ISS
GO:0003177	Process	Pulmonary valve development	ISS
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	ISS
GO:0005031	Function	Tumor necrosis factor-activated receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8069916, 10848577, 11244088, 14743216, 24070898, 25609706
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007568	Process	Aging	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA	21873635
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	TAS	24966471
GO:0016021	Component	Integral component of membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031641	Process	Regulation of myelination	ISS
GO:0031643	Process	Positive regulation of myelination	IBA	21873635
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0035579	Component	Specific granule membrane	TAS
GO:0042129	Process	Regulation of T cell proliferation	IBA	21873635
GO:0042129	Process	Regulation of T cell proliferation	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043120	Function	Tumor necrosis factor binding	IBA	21873635
GO:0043120	Function	Tumor necrosis factor binding	IPI	9435233
GO:0043196	Component	Varicosity	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045121	Component	Membrane raft	IDA	17010968
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IBA	21873635
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0050779	Process	RNA destabilization	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IBA	21873635
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IMP	22480688
GO:0060548	Process	Negative regulation of cell death	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	22480688
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA	21873635
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:0150079	Process	Negative regulation of neuroinflammatory response	IBA	21873635
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:0150098	Process	Glial cell-neuron signaling	ISS
GO:1901215	Process	Negative regulation of neuron death	IBA	21873635
GO:1901215	Process	Negative regulation of neuron death	ISS
GO:1902339	Process	Positive regulation of apoptotic process involved in morphogenesis	ISS
GO:2001141	Process	Regulation of RNA biosynthetic process	ISS

Other IDs

• MIM: 191191
• HGNC: 11917
• e!Ensembl: ENSG00000028137

Protein

• UniProt ID: P20333
• Protein name: Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)]
• Protein function: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
• PDB: 1CA9, 3ALQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	40 → 75	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	78 → 118	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	120 → 161	TNFR/NGFR cysteine-rich region	Domain

• Sequence:

  MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
  QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
  RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
  PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
  FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
  PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
  ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
  VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

• Sequence length: 461