TLR9 (toll like receptor 9)

Gene

• Entrez ID: 54106
• Gene name: Toll like receptor 9
• Gene symbol: TLR9
• Synonyms: CD289
• Chromosome: 3
• Chromosome location: 3p21.2
• Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT736441	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT2349590	hsa-miR-125a-3p	CLIP-seq
MIRT2349591	hsa-miR-3194-3p	CLIP-seq
MIRT2349592	hsa-miR-3934	CLIP-seq
MIRT2349593	hsa-miR-4710	CLIP-seq
MIRT2349594	hsa-miR-592	CLIP-seq
MIRT2349595	hsa-miR-597	CLIP-seq
MIRT2349596	hsa-miR-764	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	15294971
CREB1	Unknown	15294971
ELF1	Unknown	15294971
ELK1	Unknown	15294971
ETS2	Unknown	15294971
HDAC3	Unknown	25194054
NFKB1	Unknown	25194054
PTMA	Repression	21176371;21575365
RELA	Unknown	25194054

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002224	Process	Toll-like receptor signaling pathway	IBA	21873635
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002237	Process	Response to molecule of bacterial origin	TAS	15356140
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	23857366
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IPI	12925853
GO:0005576	Component	Extracellular region	NAS	11130078
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	19740627
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA	21873635
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0007252	Process	I-kappaB phosphorylation	IDA	19740627
GO:0010008	Component	Endosome membrane	TAS
GO:0010628	Process	Positive regulation of gene expression	IDA	24409285
GO:0016021	Component	Integral component of membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	17128265
GO:0016324	Component	Apical plasma membrane	IDA	17128265
GO:0030277	Process	Maintenance of gastrointestinal epithelium	ISS
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	23857366
GO:0032009	Component	Early phagosome	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	17128265
GO:0032640	Process	Tumor necrosis factor production	IBA	21873635
GO:0032640	Process	Tumor necrosis factor production	IDA	23826189
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032717	Process	Negative regulation of interleukin-8 production	IDA	17128265
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	24409285
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	16286015
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032741	Process	Positive regulation of interleukin-18 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA	21873635
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627, 24409285
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17128265, 19740627, 24409285
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IDA	17128265
GO:0034123	Process	Positive regulation of toll-like receptor signaling pathway	IDA	17128265
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0034163	Process	Regulation of toll-like receptor 9 signaling pathway	IDA	23857366
GO:0035197	Function	SiRNA binding	IMP	15723075
GO:0036019	Component	Endolysosome	ISS
GO:0036020	Component	Endolysosome membrane	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA	21873635
GO:0042742	Process	Defense response to bacterium	NAS	11130078
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17128265
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23857366
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	17128265
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045322	Function	Unmethylated CpG binding	ISS
GO:0045577	Process	Regulation of B cell differentiation	IDA	23857366
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IC	17128265
GO:0050729	Process	Positive regulation of inflammatory response	IC	19740627
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	22427638
GO:0050871	Process	Positive regulation of B cell activation	IDA	23857366
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	17128265
GO:0051607	Process	Defense response to virus	IBA	21873635
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	19740627
GO:1901895	Process	Negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	24610369

Other IDs

• MIM: 605474
• HGNC: 15633
• e!Ensembl: ENSG00000239732

Protein

• UniProt ID: Q9NR96
• Protein name: Toll-like receptor 9 (CD antigen CD289)
• Protein function: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by
• PDB: 8AR3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	50 → 98	Leucine rich repeat	Repeat
  PF13855	LRR_8	290 → 345	Leucine rich repeat	Repeat
  PF18837	LRR_12	393 → 422	Leucine-rich repeat	Repeat
  PF13855	LRR_8	701 → 762	Leucine rich repeat	Repeat
  PF01582	TIR	870 → 1030	TIR domain	Family

• Sequence:

  MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
  PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
  AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
  KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
  ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
  ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
  GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
  DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
  RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
  FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
  RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
  RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
  FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
  VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
  WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
  RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
  DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
  YNRNFCQGPTAE

• Sequence length: 1032