GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

TLR4 (toll like receptor 4)

Gene

7099

Toll like receptor 4

TLR4

ARMD10, CD284, TLR-4, TOLL

9q33.1

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

Show/Hide all(210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003050	hsa-let-7i-5p	Luciferase reporter assay, qRT-PCR, Western blot	17660297
MIRT003050	hsa-let-7i-5p	Luciferase reporter assay, qRT-PCR, Western blot	17660297
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT018411	hsa-miR-335-5p	Microarray	18185580
MIRT023907	hsa-miR-1-3p	Microarray	18668037
MIRT031004	hsa-miR-21-5p	Microarray	18591254
MIRT053375	hsa-miR-146b-5p	Luciferase reporter assay, qRT-PCR	23798430
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT722926	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT722925	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722924	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT722923	hsa-miR-4738-3p	HITS-CLIP	19536157
MIRT722922	hsa-miR-630	HITS-CLIP	19536157
MIRT722921	hsa-miR-4279	HITS-CLIP	19536157
MIRT722920	hsa-miR-3658	HITS-CLIP	19536157
MIRT722919	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT722918	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT449831	hsa-miR-4694-3p	PAR-CLIP	22100165
MIRT449830	hsa-miR-4698	PAR-CLIP	22100165
MIRT449829	hsa-miR-1468-3p	PAR-CLIP	22100165
MIRT449828	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT449827	hsa-miR-6077	PAR-CLIP	22100165
MIRT449826	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT732201	hsa-miR-26b-5p	qPCR, Luciferase reporter assay	26222045
MIRT732201	hsa-miR-26b-5p	qRT-PCR, Luciferase reporter assay	26222045
MIRT732436	hsa-miR-485-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	34103911
MIRT449829	hsa-miR-1468-3p	Immunofluorescence, qRT-PCR	34073556
MIRT732637	hsa-miR-5787	ELISA, Immunofluorescence, Luciferase reporter assay, Western blotting	33165670
MIRT732899	hsa-miR-140-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, Flow cytometry	33122931
MIRT733048	hsa-miR-202-3p	ELISA, qRT-PCR	33893248
MIRT733483	hsa-miR-4268	Immunofluorescence, RNA-seq, qRT-PCR, Western blotting	34120606
MIRT733771	hsa-miR-23b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	34110366
MIRT734334	hsa-miR-146a-3p	qRT-PCR, Western blotting	32176822
MIRT732899	hsa-miR-140-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	32073611
MIRT735023	hsa-miR-301a-3p	ELISA	33121303
MIRT006530	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT735567	hsa-miR-329-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33262815
MIRT735572	hsa-miR-885-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	31763742
MIRT735623	hsa-miR-216a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, ELISA	32019561
MIRT732899	hsa-miR-140-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, In situ hybridization, Flow cytometry	31769066
MIRT736832	hsa-miR-103a-3p	qRT-PCR	32941517
MIRT736833	hsa-miR-107	qRT-PCR	32941517
MIRT737245	hsa-miR-145-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32801865
MIRT737392	hsa-miR-1178-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), RNA-seq, qRT-PCR	32059341
MIRT722926	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT722925	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722924	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT722923	hsa-miR-4738-3p	HITS-CLIP	19536157
MIRT722922	hsa-miR-630	HITS-CLIP	19536157
MIRT722921	hsa-miR-4279	HITS-CLIP	19536157
MIRT722920	hsa-miR-3658	HITS-CLIP	19536157
MIRT722919	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT722918	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT449831	hsa-miR-4694-3p	PAR-CLIP	22100165
MIRT449830	hsa-miR-4698	PAR-CLIP	22100165
MIRT449829	hsa-miR-1468-3p	PAR-CLIP	22100165
MIRT449828	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT449827	hsa-miR-6077	PAR-CLIP	22100165
MIRT449826	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT735572	hsa-miR-885-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35156897
MIRT755856	hsa-miR-711	Luciferase reporter assay, Western blotting, qRT-PCR	36114541
MIRT755896	hsa-miR-16-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence, ELISA	34854364
MIRT755916	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35722425
MIRT722922	hsa-miR-630	Luciferase reporter assay, qRT-PCR	36926413
MIRT756208	hsa-miR-4512	Luciferase reporter assay, Western blotting, qRT-PCR	34721432
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2127864	hsa-miR-181a	CLIP-seq
MIRT2127865	hsa-miR-181b	CLIP-seq
MIRT2127866	hsa-miR-181c	CLIP-seq
MIRT2127867	hsa-miR-181d	CLIP-seq
MIRT2127868	hsa-miR-197	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2127870	hsa-miR-2053	CLIP-seq
MIRT2127871	hsa-miR-216a	CLIP-seq
MIRT2127872	hsa-miR-216b	CLIP-seq
MIRT2127873	hsa-miR-23a	CLIP-seq
MIRT2127874	hsa-miR-23b	CLIP-seq
MIRT2127875	hsa-miR-23c	CLIP-seq
MIRT2127876	hsa-miR-3160-5p	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2127881	hsa-miR-3929	CLIP-seq
MIRT2127882	hsa-miR-4262	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2127884	hsa-miR-4311	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2127886	hsa-miR-433	CLIP-seq
MIRT2127887	hsa-miR-4419b	CLIP-seq
MIRT2127888	hsa-miR-4427	CLIP-seq
MIRT2127889	hsa-miR-4478	CLIP-seq
MIRT2127890	hsa-miR-4645-3p	CLIP-seq
MIRT2127891	hsa-miR-4693-5p	CLIP-seq
MIRT2127892	hsa-miR-4761-5p	CLIP-seq
MIRT2127893	hsa-miR-548ag	CLIP-seq
MIRT2127894	hsa-miR-548ai	CLIP-seq
MIRT2127895	hsa-miR-550b	CLIP-seq
MIRT2127896	hsa-miR-569	CLIP-seq
MIRT2127897	hsa-miR-889	CLIP-seq
MIRT2127898	hsa-miR-892a	CLIP-seq
MIRT2127899	hsa-miR-944	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2349552	hsa-miR-3940-5p	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2349553	hsa-miR-4507	CLIP-seq
MIRT2349554	hsa-miR-587	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643048	hsa-miR-122	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2643049	hsa-miR-1279	CLIP-seq
MIRT2643050	hsa-miR-145	CLIP-seq
MIRT2643051	hsa-miR-18a	CLIP-seq
MIRT2643052	hsa-miR-18b	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2643053	hsa-miR-2052	CLIP-seq
MIRT2643054	hsa-miR-219-5p	CLIP-seq
MIRT2643055	hsa-miR-2355-3p	CLIP-seq
MIRT2643056	hsa-miR-3064-3p	CLIP-seq
MIRT2643057	hsa-miR-3117-5p	CLIP-seq
MIRT2643058	hsa-miR-3180-5p	CLIP-seq
MIRT2643059	hsa-miR-345	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2643060	hsa-miR-3913-3p	CLIP-seq
MIRT2643061	hsa-miR-3920	CLIP-seq
MIRT2643062	hsa-miR-4256	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2643063	hsa-miR-4303	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2643064	hsa-miR-4328	CLIP-seq
MIRT2643065	hsa-miR-4445	CLIP-seq
MIRT2643066	hsa-miR-4635	CLIP-seq
MIRT2643067	hsa-miR-4652-3p	CLIP-seq
MIRT2643068	hsa-miR-4680-3p	CLIP-seq
MIRT2643069	hsa-miR-4735-3p	CLIP-seq
MIRT2643070	hsa-miR-4762-3p	CLIP-seq
MIRT2643071	hsa-miR-4782-3p	CLIP-seq
MIRT2643072	hsa-miR-4793-5p	CLIP-seq
MIRT2643073	hsa-miR-489	CLIP-seq
MIRT2643074	hsa-miR-508-3p	CLIP-seq
MIRT2643075	hsa-miR-511	CLIP-seq
MIRT2643076	hsa-miR-514	CLIP-seq
MIRT2643077	hsa-miR-514b-3p	CLIP-seq
MIRT2643078	hsa-miR-526b	CLIP-seq
MIRT2643079	hsa-miR-549	CLIP-seq
MIRT2643080	hsa-miR-578	CLIP-seq
MIRT2643081	hsa-miR-579	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643082	hsa-miR-676	CLIP-seq
MIRT2643083	hsa-miR-943	CLIP-seq
MIRT2643048	hsa-miR-122	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2643049	hsa-miR-1279	CLIP-seq
MIRT2693220	hsa-miR-1298	CLIP-seq
MIRT2643050	hsa-miR-145	CLIP-seq
MIRT2643051	hsa-miR-18a	CLIP-seq
MIRT2643052	hsa-miR-18b	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2643053	hsa-miR-2052	CLIP-seq
MIRT2643054	hsa-miR-219-5p	CLIP-seq
MIRT2643055	hsa-miR-2355-3p	CLIP-seq
MIRT2643056	hsa-miR-3064-3p	CLIP-seq
MIRT2643057	hsa-miR-3117-5p	CLIP-seq
MIRT2643058	hsa-miR-3180-5p	CLIP-seq
MIRT2643059	hsa-miR-345	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2643060	hsa-miR-3913-3p	CLIP-seq
MIRT2643061	hsa-miR-3920	CLIP-seq
MIRT2643062	hsa-miR-4256	CLIP-seq
MIRT2693221	hsa-miR-4275	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2643064	hsa-miR-4328	CLIP-seq
MIRT2643065	hsa-miR-4445	CLIP-seq
MIRT2643066	hsa-miR-4635	CLIP-seq
MIRT2643068	hsa-miR-4680-3p	CLIP-seq
MIRT2643069	hsa-miR-4735-3p	CLIP-seq
MIRT2643070	hsa-miR-4762-3p	CLIP-seq
MIRT2693222	hsa-miR-4774-5p	CLIP-seq
MIRT2643071	hsa-miR-4782-3p	CLIP-seq
MIRT2643072	hsa-miR-4793-5p	CLIP-seq
MIRT2643073	hsa-miR-489	CLIP-seq
MIRT2643074	hsa-miR-508-3p	CLIP-seq
MIRT2643075	hsa-miR-511	CLIP-seq
MIRT2643076	hsa-miR-514	CLIP-seq
MIRT2643077	hsa-miR-514b-3p	CLIP-seq
MIRT2643078	hsa-miR-526b	CLIP-seq
MIRT2643079	hsa-miR-549	CLIP-seq
MIRT2643080	hsa-miR-578	CLIP-seq
MIRT2643081	hsa-miR-579	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643082	hsa-miR-676	CLIP-seq
MIRT2643083	hsa-miR-943	CLIP-seq
MIRT2127899	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
IRF3	Unknown	22208359
IRF8	Unknown	10734131
SPI1	Activation	16785240;20956019
SPI1	Unknown	10734131
STAT6	Repression	16433852
ZNF160	Repression	19846881

Show/Hide all(130)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	ISS
GO:0001530	Function	Lipopolysaccharide binding	IBA	21873635
GO:0001530	Function	Lipopolysaccharide binding	IMP	16514062
GO:0001530	Function	Lipopolysaccharide binding	NAS	10835634
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001726	Component	Ruffle	IEA
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IBA	21873635
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IDA	19252480
GO:0001891	Component	Phagocytic cup	IDA	30883606
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IBA	21873635
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002322	Process	B cell proliferation involved in immune response	IEA
GO:0002537	Process	Nitric oxide production involved in inflammatory response	IEA
GO:0002730	Process	Regulation of dendritic cell cytokine production	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0004888	Function	Transmembrane signaling receptor activity	NAS	11970998
GO:0005102	Function	Signaling receptor binding	IPI	20037584
GO:0005515	Function	Protein binding	IPI	11441107, 11544529, 12925853, 15356101, 15728506, 16622205, 17064675, 17126326, 17258210, 17803912, 19252480, 19509286, 20037584, 20067962, 20547845, 21829704, 21903422, 25187624, 29150600
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005737	Component	Cytoplasm	IPI	20037584
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IDA	16338228, 19740627
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	15027902
GO:0006909	Process	Phagocytosis	IDA	30883606
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	TAS	10426995
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007252	Process	I-kappaB phosphorylation	IDA	19740627
GO:0009897	Component	External side of plasma membrane	IDA	16514062
GO:0009986	Component	Cell surface	IDA	25204797
GO:0010008	Component	Endosome membrane	TAS
GO:0010572	Process	Positive regulation of platelet activation	ISS	16514062
GO:0010628	Process	Positive regulation of gene expression	IMP	23817958
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA
GO:0014002	Process	Astrocyte development	IEA
GO:0016046	Process	Detection of fungus	NAS	11254600
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031226	Component	Intrinsic component of plasma membrane	IDA	11274165
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	10880523
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IGI	10880523
GO:0032496	Process	Response to lipopolysaccharide	IC	16514062
GO:0032496	Process	Response to lipopolysaccharide	IDA	12594207
GO:0032497	Process	Detection of lipopolysaccharide	IDA	19252480
GO:0032611	Process	Interleukin-1 beta production	ISS
GO:0032689	Process	Negative regulation of interferon-gamma production	ISS
GO:0032700	Process	Negative regulation of interleukin-17 production	ISS
GO:0032707	Process	Negative regulation of interleukin-23 production	ISS
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032727	Process	Positive regulation of interferon-alpha production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032729	Process	Positive regulation of interferon-gamma production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	11432859
GO:0032732	Process	Positive regulation of interleukin-1 production	ISS
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	15027902
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	21329689, 30321456
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17951129, 19740627, 21329689
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	17951129
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	30321456
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034128	Process	Negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	ISS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0042088	Process	T-helper 1 type immune response	NAS	11970998
GO:0042116	Process	Macrophage activation	IMP	10835634
GO:0042742	Process	Defense response to bacterium	IGI	30321456
GO:0042742	Process	Defense response to bacterium	TAS	10426995
GO:0042802	Function	Identical protein binding	IPI	23059983, 23155421
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043235	Component	Receptor complex	IPI	20037584
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045671	Process	Negative regulation of osteoclast differentiation	NAS	12133979
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	11274165, 19252480
GO:0046982	Function	Protein heterodimerization activity	IPI	20037584
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15027902
GO:0050135	Function	NAD(P)+ nucleosidase activity	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	19740627
GO:0050729	Process	Positive regulation of inflammatory response	IMP	21329689
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA	21873635
GO:0050829	Process	Defense response to Gram-negative bacterium	IC	16514062
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12594207, 29038465
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IGI	20037584
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	30233718
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:0060729	Process	Intestinal epithelial structure maintenance	ISS
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0061809	Function	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA
GO:0070266	Process	Necroptotic process	TAS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070430	Process	Positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	11432859
GO:0071222	Process	Cellular response to lipopolysaccharide	IGI	30321456
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071346	Process	Cellular response to interferon-gamma	IDA	11672593
GO:0097190	Process	Apoptotic signaling pathway	TAS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	26370079
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IMP	30321456
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	19740627
GO:1903223	Process	Positive regulation of oxidative stress-induced neuron death	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1903974	Process	Positive regulation of cellular response to macrophage colony-stimulating factor stimulus	IDA	11672593
GO:1904466	Process	Positive regulation of matrix metallopeptidase secretion	IMP	21329689
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IMP	21329689

MIM	HGNC	e!Ensembl
603030	11850	ENSG00000136869

Protein

UniProt ID

O00206

Protein name

Toll-like receptor 4 (hToll) (CD antigen CD284)

Protein function

Transmembrane receptor that functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways (PubMed:10835634, PubMed

PDB

2Z62 , 2Z63 , 2Z65 , 2Z66 , 3FXI , 3UL7 , 3UL8 , 3UL9 , 3ULA , 4G8A , 5NAM , 5NAO , 8WO1 , 8WTA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	55 → 114	Leucine rich repeat	Repeat
PF13855	LRR_8	78 → 138	Leucine rich repeat	Repeat
PF13855	LRR_8	126 → 187	Leucine rich repeat	Repeat
PF13855	LRR_8	150 → 207	Leucine rich repeat	Repeat
PF13855	LRR_8	447 → 508	Leucine rich repeat	Repeat
PF13855	LRR_8	485 → 532	Leucine rich repeat	Repeat
PF13855	LRR_8	496 → 556	Leucine rich repeat	Repeat
PF01582	TIR	674 → 839	TIR domain	Family

Sequence

MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

Sequence length

839

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412