TJP1 (tight junction protein 1)

Gene

• Entrez ID: 7082
• Gene name: Tight junction protein 1
• Gene symbol: TJP1
• Synonyms: ZO-1
• Chromosome: 15
• Chromosome location: 15q13.1
• Summary: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family of proteins, and acts as a tight junction adaptor protein that also regulates adherens junctions. Tight junctions regulate the movement of ions and macromolecules between endothelial and epithelial cells. The multidomain structure of this scaffold protein, including a postsynaptic density 95/disc-large/zona occludens (PDZ) domain, a Src homology (SH3) domain, a guanylate kinase (GuK) domain and unique (U) motifs all help to co-ordinate binding of transmembrane proteins, cytosolic proteins, and F-actin, which are required for tight junction function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004341	hsa-miR-212-3p	Western blot, Luciferase reporter assay	18162065
MIRT020884	hsa-miR-155-5p	Proteomics	18668040
MIRT039699	hsa-miR-615-3p	CLASH	23622248
MIRT042969	hsa-miR-324-3p	CLASH	23622248
MIRT050793	hsa-miR-17-5p	CLASH	23622248
MIRT051942	hsa-let-7b-5p	CLASH	23622248
MIRT438931	hsa-miR-105-5p	In situ hybridization, qRT-PCR, Luciferase reporter assay, Western blot, Microarray	24735924
MIRT553625	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT553626	hsa-miR-194-5p	PAR-CLIP	21572407
MIRT553627	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT553628	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT553629	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT553630	hsa-miR-107	PAR-CLIP	21572407
MIRT553631	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT553632	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT698459	hsa-miR-802	HITS-CLIP	23313552
MIRT698460	hsa-miR-4801	HITS-CLIP	23313552
MIRT698461	hsa-miR-5700	HITS-CLIP	23313552
MIRT698462	hsa-miR-4731-3p	HITS-CLIP	23313552
MIRT698463	hsa-miR-5582-3p	HITS-CLIP	23313552
MIRT698464	hsa-miR-548x-3p	HITS-CLIP	23313552
MIRT698465	hsa-miR-548j-3p	HITS-CLIP	23313552
MIRT698466	hsa-miR-548aq-3p	HITS-CLIP	23313552
MIRT698467	hsa-miR-548am-3p	HITS-CLIP	23313552
MIRT698468	hsa-miR-548aj-3p	HITS-CLIP	23313552
MIRT698469	hsa-miR-548ah-3p	HITS-CLIP	23313552
MIRT698470	hsa-miR-548ae-3p	HITS-CLIP	23313552
MIRT698471	hsa-miR-548z	HITS-CLIP	23313552
MIRT698472	hsa-miR-548h-3p	HITS-CLIP	23313552
MIRT698473	hsa-miR-548d-3p	HITS-CLIP	23313552
MIRT698474	hsa-miR-548bb-3p	HITS-CLIP	23313552
MIRT698475	hsa-miR-548ac	HITS-CLIP	23313552
MIRT732222	hsa-miR-212-5p	Luciferase reporter assay, Western blot	26692142
MIRT735047	hsa-miR-34c-5p	qRT-PCR, Western blot	28153728

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	18535113
HDAC1	Repression	20580679

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IEA
GO:0005515	Function	Protein binding	IPI	9707407, 11042084, 11734628, 12154091, 16944923, 17015620, 17724469, 18823282, 19332538, 20164257, 20850437, 21402783, 22262837, 23885123, 25753039, 28661558, 29366904, 30992345, 31473225
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11734628
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	11090614
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	TAS	8486731
GO:0005921	Component	Gap junction	ISS
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0005923	Component	Bicellular tight junction	IDA	11734628, 14757759, 18823282, 22006950
GO:0007043	Process	Cell-cell junction assembly	TAS	8486731
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	29771433
GO:0016323	Component	Basolateral plasma membrane	IDA	16427635
GO:0030054	Component	Cell junction	IDA	28169360
GO:0030054	Component	Cell junction	TAS
GO:0030335	Process	Positive regulation of cell migration	IMP	25753039
GO:0031032	Process	Actomyosin structure organization	IMP	25753039
GO:0032991	Component	Protein-containing complex	IDA	25753039
GO:0034334	Process	Adherens junction maintenance	IMP	25753039
GO:0035329	Process	Hippo signaling	TAS
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	29771433
GO:0043296	Component	Apical junction complex	IDA	16427635
GO:0045177	Component	Apical part of cell	IDA	22006950
GO:0045216	Process	Cell-cell junction organization	IBA	21873635
GO:0045216	Process	Cell-cell junction organization	IMP	25753039
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0050839	Function	Cell adhesion molecule binding	IBA	21873635
GO:0051493	Process	Regulation of cytoskeleton organization	IMP	25753039
GO:0051497	Process	Negative regulation of stress fiber assembly	ISS
GO:0070160	Component	Tight junction	IDA	22855531, 27037668, 30734065
GO:0070160	Component	Tight junction	IMP	24854121
GO:0071896	Process	Protein localization to adherens junction	IMP	25753039
GO:0090557	Process	Establishment of endothelial intestinal barrier	IBA	21873635
GO:0090557	Process	Establishment of endothelial intestinal barrier	IMP	23885123
GO:0098609	Process	Cell-cell adhesion	IBA	21873635
GO:0150105	Process	Protein localization to cell-cell junction	IBA	21873635
GO:0150105	Process	Protein localization to cell-cell junction	IMP	25753039
GO:1901888	Process	Regulation of cell junction assembly	IMP	25753039
GO:1902396	Process	Protein localization to bicellular tight junction	IMP	25753039
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	25753039
GO:1905605	Process	Positive regulation of blood-brain barrier permeability	IBA	21873635
GO:1905605	Process	Positive regulation of blood-brain barrier permeability	IMP	24854121
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IMP	25753039
GO:2000250	Process	Negative regulation of actin cytoskeleton reorganization	IMP	25753039
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	25753039
GO:2000810	Process	Regulation of bicellular tight junction assembly	TAS

Other IDs

• MIM: 601009
• HGNC: 11827
• e!Ensembl: ENSG00000104067

Protein

• UniProt ID: Q07157
• Protein name: Tight junction protein ZO-1 (Tight junction protein 1) (Zona occludens protein 1) (Zonula occludens protein 1)
• Protein function: TJP1, TJP2, and TJP3 are closely related scaffolding proteins that link tight junction (TJ) transmembrane proteins such as claudins, junctional adhesion molecules, and occludin to the actin cytoskeleton (PubMed:7798316, PubMed:9792688). The tight junction acts to limit movement of substances through the paracellular space and as a boundary between the compositionally distinct apical and basolateral plasma membrane domains of epithelial and endothelial cells. Necessary for lumenogenesis, and particularly efficient epithelial polarization and barrier formation (By similarity). Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells (PubMed:21240187). Plays an important role in podosome formation and associated function, thus regulating cell adhesion and matrix remodeling (PubMed:20930113). With TJP2 and TJP3, participates in the junctional retention and stability of the transcription factor DBPA, but is not involved in its shuttling to the nucleus (By similarity).
• PDB: 2H2B, 2H2C, 2H3M, 2JWE, 2KXR, 2KXS, 2RCZ, 3CYY, 3LH5, 3SHU, 3SHW, 3TSV, 3TSW, 3TSZ, 4OEO, 4OEP, 4Q2Q, 4YYX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	23 → 107	PDZ domain	Domain
  PF00595	PDZ	186 → 261	PDZ domain	Domain
  PF00595	PDZ	422 → 501	PDZ domain	Domain
  PF07653	SH3_2	520 → 582	Variant SH3 domain	Domain
  PF00625	Guanylate_kin	681 → 793	Guanylate kinase	Domain
  PF00791	ZU5	1635 → 1727	ZU5 domain	Family

• Sequence:

  MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
  KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD
  PEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQ
  PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
  SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
  GRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHAD
  DHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP
  SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
  EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
  EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
  FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
  LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
  WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
  GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
  SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
  QAQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPT
  PAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLK
  QPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESSSYTDQFSRNYEHRLRY
  EDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPLSY
  DSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQYFEQYSRSYE
  QVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK
  PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHD
  KTLYRIPEPQKPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHL
  SEPAKPAHSQNQSNFSSYSSKGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQ
  PVTSASLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYP
  QKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHK
  PDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSA
  VEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS
  ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANC
  VSVLIDHF

• Sequence length: 1748