TIRAP (TIR domain containing adaptor protein)

Gene

• Entrez ID: 114609
• Gene name: TIR domain containing adaptor protein
• Gene symbol: TIRAP
• Synonyms: BACTS1, Mal, MyD88-2, wyatt
• Chromosome: 11
• Chromosome location: 11q24.2
• Summary: The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004748	hsa-miR-145-5p	Immunoprecipitaion, Western blot, Communoprecipitaion	19898489
MIRT674487	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT674488	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT674489	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT674490	hsa-miR-4435	HITS-CLIP	23824327
MIRT674491	hsa-miR-588	HITS-CLIP	23824327
MIRT674492	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT674493	hsa-miR-548s	HITS-CLIP	23824327
MIRT674494	hsa-miR-640	HITS-CLIP	23824327
MIRT674495	hsa-miR-203b-3p	HITS-CLIP	23824327
MIRT674496	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT674497	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT674498	hsa-miR-8086	HITS-CLIP	23824327
MIRT674499	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674500	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT674501	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT674502	hsa-miR-4680-5p	HITS-CLIP	23824327
MIRT674503	hsa-miR-4635	HITS-CLIP	23824327
MIRT674504	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT674505	hsa-miR-764	HITS-CLIP	23824327
MIRT674506	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT737036	hsa-miR-1285-3p	PAR-CLIP	26701625
MIRT738651	hsa-miR-196a-3p	PAR-CLIP	26701625
MIRT739369	hsa-miR-25-3p	PAR-CLIP	26701625
MIRT740931	hsa-miR-3187-5p	PAR-CLIP	26701625
MIRT741262	hsa-miR-32-5p	PAR-CLIP	26701625
MIRT741814	hsa-miR-363-3p	PAR-CLIP	26701625
MIRT742130	hsa-miR-367-3p	PAR-CLIP	26701625
MIRT744084	hsa-miR-4325	PAR-CLIP	26701625
MIRT749623	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT749892	hsa-miR-5189-5p	PAR-CLIP	26701625
MIRT750996	hsa-miR-5586-3p	PAR-CLIP	26701625
MIRT752234	hsa-miR-612	PAR-CLIP	26701625
MIRT753236	hsa-miR-6512-3p	PAR-CLIP	26701625
MIRT753565	hsa-miR-661	PAR-CLIP	26701625
MIRT753768	hsa-miR-6720-5p	PAR-CLIP	26701625
MIRT757554	hsa-miR-6849-3p	PAR-CLIP	26701625
MIRT757865	hsa-miR-6860	PAR-CLIP	26701625
MIRT759622	hsa-miR-766-3p	PAR-CLIP	26701625
MIRT759720	hsa-miR-7703	PAR-CLIP	26701625
MIRT760632	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT760660	hsa-miR-92b-3p	PAR-CLIP	26701625
MIRT760730	hsa-miR-939-3p	PAR-CLIP	26701625
MIRT762433	hsa-miR-1304-3p	PAR-CLIP	27292025
MIRT763435	hsa-miR-1915-3p	PAR-CLIP	27292025
MIRT765062	hsa-miR-3155a	PAR-CLIP	27292025
MIRT765067	hsa-miR-3155b	PAR-CLIP	27292025
MIRT771667	hsa-miR-4726-3p	PAR-CLIP	27292025
MIRT772212	hsa-miR-4772-3p	PAR-CLIP	27292025
MIRT772584	hsa-miR-484	PAR-CLIP	27292025
MIRT772911	hsa-miR-5001-3p	PAR-CLIP	27292025
MIRT774679	hsa-miR-5571-5p	PAR-CLIP	27292025
MIRT778052	hsa-miR-6736-3p	PAR-CLIP	27292025
MIRT778524	hsa-miR-6764-5p	PAR-CLIP	27292025
MIRT778834	hsa-miR-6778-3p	PAR-CLIP	27292025
MIRT779210	hsa-miR-6787-3p	PAR-CLIP	27292025
MIRT779298	hsa-miR-6791-3p	PAR-CLIP	27292025
MIRT779986	hsa-miR-6829-3p	PAR-CLIP	27292025
MIRT780055	hsa-miR-6836-3p	PAR-CLIP	27292025
MIRT780190	hsa-miR-6840-3p	PAR-CLIP	27292025
MIRT781150	hsa-miR-6890-3p	PAR-CLIP	27292025

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS	19509286
GO:0005080	Function	Protein kinase C binding	IPI	17161867
GO:0005515	Function	Protein binding	IPI	11544529, 17258210, 17583698, 19509286, 19574958, 19948740, 21334391, 21829704, 21903422, 22155231, 24275656
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS
GO:0005737	Component	Cytoplasm	IDA	19948740
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	19948740
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	IMP	24275656
GO:0030099	Process	Myeloid cell differentiation	ISS
GO:0030139	Component	Endocytic vesicle	ISS
GO:0030674	Function	Protein-macromolecule adaptor activity	NAS	19509286
GO:0030890	Process	Positive regulation of B cell proliferation	ISS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	12062447
GO:0032496	Process	Response to lipopolysaccharide	IDA	11544529
GO:0032587	Component	Ruffle membrane	ISS
GO:0032648	Process	Regulation of interferon-beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032738	Process	Positive regulation of interleukin-15 production	IDA	18583567
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	16301656
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16301656
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16301656, 19509286
GO:0034137	Process	Positive regulation of toll-like receptor 2 signaling pathway	IMP	19509286
GO:0034141	Process	Positive regulation of toll-like receptor 3 signaling pathway	ISS
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IMP	19509286
GO:0035662	Function	Toll-like receptor 4 binding	IPI	19509286
GO:0035663	Function	Toll-like receptor 2 binding	IPI	19509286
GO:0035665	Process	TIRAP-dependent toll-like receptor 4 signaling pathway	IDA	11544529
GO:0042802	Function	Identical protein binding	IPI	17258210, 24275656
GO:0042802	Function	Identical protein binding	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	19509286
GO:0045087	Process	Innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	IC	19509286
GO:0046330	Process	Positive regulation of JNK cascade	IMP	11544529
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	19509286
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	11544529
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	15294994
GO:0071221	Process	Cellular response to bacterial lipopeptide	ISS
GO:0071223	Process	Cellular response to lipoteichoic acid	ISS
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	ISS
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	ISS
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	ISS

Other IDs

• MIM: 606252
• HGNC: 17192
• e!Ensembl: ENSG00000150455

Protein

• UniProt ID: P58753
• Protein name: Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)
• Protein function: Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6.
• PDB: 2NDH, 2Y92, 3UB2, 3UB3, 3UB4, 4FZ5, 4LQD, 5T7Q, 5UZB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13676	TIR_2	88 → 211	TIR domain	Domain

• Sequence:

  MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
  LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
  RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
  GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS

• Sequence length: 221