GediPNet logo

TIRAP (TIR domain containing adaptor protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114609
Gene nameGene Name - the full gene name approved by the HGNC.
TIR domain containing adaptor protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TIRAP
SynonymsGene synonyms aliases
BACTS1, Mal, MyD88-2, wyatt
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.2
SummarySummary of gene provided in NCBI Entrez Gene.
The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004748 hsa-miR-145-5p Immunoprecipitaion, Western blot, Communoprecipitaion 19898489
MIRT674506 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT674505 hsa-miR-764 HITS-CLIP 23824327
MIRT674504 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT674503 hsa-miR-4635 HITS-CLIP 23824327
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 19509286
GO:0005080 Function Protein kinase C binding IPI 17161867
GO:0005515 Function Protein binding IPI 11544529, 17258210, 17583698, 19509286, 19574958, 19948740, 21334391, 21829704, 21903422, 22155231, 24275656
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding ISS
GO:0005737 Component Cytoplasm IDA 19948740
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P58753
Protein name Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)
Protein function Adapter involved in TLR2, TLR4 and RAGE signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response
PDB 2NDH , 2Y92 , 3UB2 , 3UB3 , 3UB4 , 4FZ5 , 4LQD , 5T7Q , 5UZB , 8JZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13676 TIR_2
88 211
TIR domain
Domain
Sequence
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKE
AVMRYLQTLS
Sequence length 221
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412