GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

TGFBR2 (transforming growth factor beta receptor 2)

Gene

7048

Transforming growth factor beta receptor 2

TGFBR2

AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TBR-ii, TBRII, TGFR-2, TGFbeta-RII

3p24.1

The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. [provided by RefSeq, Aug 2017]

Show/Hide all(77)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28934568	T>C	Pathogenic	Missense variant, coding sequence variant
rs34833812	C>T	Conflicting-interpretations-of-pathogenicity, pathogenic, benign-likely-benign, benign, likely-pathogenic, likely-benign	Coding sequence variant, missense variant
rs35719192	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign	Coding sequence variant, missense variant
rs35766612	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign, benign, likely-benign, not-provided	Coding sequence variant, missense variant
rs61732532	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, coding sequence variant, missense variant, genic upstream transcript variant
rs79375991	A>-,AA	Uncertain-significance, benign, likely-pathogenic	Frameshift variant, coding sequence variant
rs104893807	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs104893809	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893810	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893811	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893812	T>A,G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104893813	G>A,C,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104893814	G>T	Pathogenic	Missense variant, coding sequence variant
rs104893815	G>A	Pathogenic	Missense variant, coding sequence variant
rs104893816	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs104893817	A>C,G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104893818	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893819	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs112215250	T>A	Benign, conflicting-interpretations-of-pathogenicity, benign-likely-benign, likely-benign	Missense variant, coding sequence variant
rs121918714	G>C	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs121918715	G>A	Pathogenic	Synonymous variant, coding sequence variant
rs138262219	C>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Genic upstream transcript variant, missense variant, intron variant, coding sequence variant
rs150022335	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs193922660	A>G	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs193922664	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs193922665	C>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs199660234	C>G,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs200630803	A>C,G	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs377499122	G>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs397516840	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs587776769	->TG	Pathogenic	Coding sequence variant, frameshift variant
rs587776770	A>G	Pathogenic	Splice acceptor variant
rs587782979	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs727503475	G>A,T	Pathogenic, likely-pathogenic	Splice donor variant
rs727503476	C>T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs727503477	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs727504292	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs727504406	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Missense variant, coding sequence variant
rs727504421	G>A,T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs730880224	C>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs768385200	A>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Coding sequence variant, missense variant
rs768508812	C>G,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, synonymous variant
rs779131465	A>G	Pathogenic	Splice acceptor variant
rs863223841	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863223842	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs863223843	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs863223844	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863223845	G>A,T	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs863223847	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs863223848	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs863223849	G>A	Pathogenic	Missense variant, coding sequence variant
rs863223850	C>T	Pathogenic	Missense variant, coding sequence variant
rs863223851	T>G	Likely-pathogenic	Missense variant, coding sequence variant
rs863223852	C>A,T	Pathogenic, uncertain-significance	Stop gained, coding sequence variant, synonymous variant
rs863223853	G>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs863223854	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs863223857	A>G	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs863224935	T>A,G	Likely-pathogenic, pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs869025537	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs876658120	ACGTTGACTGAG>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs878854610	A>G,T	Pathogenic	Missense variant, coding sequence variant
rs878854611	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs886038787	A>G	Pathogenic	Missense variant, coding sequence variant
rs886038794	G>T	Pathogenic	Missense variant, coding sequence variant
rs886038847	A>T	Pathogenic	Missense variant, coding sequence variant
rs886039106	G>A	Pathogenic	Missense variant, coding sequence variant
rs886039551	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1057524810	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1060501984	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1553630221	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1553630426	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1553630457	T>C	Pathogenic	Missense variant, coding sequence variant
rs1553631693	G>A	Pathogenic	Splice acceptor variant
rs1559466824	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1559472349	CT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1575165272	G>A	Pathogenic	Stop gained, coding sequence variant
rs1575166666	T>C	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(222)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001189	hsa-miR-21-5p	qRT-PCR, Western blot	19906824
MIRT001189	hsa-miR-21-5p	qRT-PCR, Luciferase reporter assay, Western blot, Reporter assay	19816956
MIRT001189	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	18829576
MIRT001189	hsa-miR-21-5p	Luciferase reporter assay, Western blot	22072622
MIRT001189	hsa-miR-21-5p	Microarray	18591254
MIRT001189	hsa-miR-21-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24037531
MIRT001189	hsa-miR-21-5p	Luciferase reporter assay	27388239
MIRT001785	hsa-miR-20a-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20940405
MIRT001785	hsa-miR-20a-5p	Microarray, qRT-PCR	19435428
MIRT001785	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Reporter assay	16461460
MIRT001785	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT001785	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT001785	hsa-miR-20a-5p	Luciferase reporter assay	27080303
MIRT001785	hsa-miR-20a-5p	Immunoblot, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR	27508097
MIRT001785	hsa-miR-20a-5p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	26729221
MIRT003272	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003272	hsa-miR-204-5p	Microarray	21282569
MIRT004591	hsa-miR-17-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20940405
MIRT004591	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT004591	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT004591	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT004591	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT004591	hsa-miR-17-5p	qRT-PCR, Luciferase reporter assay, Western blot	25011053
MIRT004591	hsa-miR-17-5p	Luciferase reporter assay, Immunohistochemistry, qRT-PCR, Western blot	27120811
MIRT004591	hsa-miR-17-5p	Immunoblot, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR	27508097
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assay, Microarray	20940405
MIRT004592	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28131417
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay, Microarray	20940405
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	24220575
MIRT004593	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT004593	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT004593	hsa-miR-19a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25443138
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	27080303
MIRT004593	hsa-miR-19a-3p	Luciferase reporter assay	27098600
MIRT004594	hsa-miR-19b-3p	Microarray, qRT-PCR	19435428
MIRT004594	hsa-miR-19b-3p	Sequencing, PAR-CLIP	20371350
MIRT004594	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT004594	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT004594	hsa-miR-19b-3p	Luciferase reporter assay	27098600
MIRT004594	hsa-miR-19b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28083843
MIRT004619	hsa-miR-590-5p	Luciferase reporter assay, qRT-PCR, Western blot	19398468
MIRT004737	hsa-miR-92a-3p	Microarray, qRT-PCR	19435428
MIRT004737	hsa-miR-92a-3p	Luciferase reporter assay, Microarray	20940405
MIRT005930	hsa-miR-302b-3p	Immunocytochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21490602
MIRT005931	hsa-miR-372-3p	Immunocytochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21490602
MIRT005931	hsa-miR-372-3p	Luciferase reporter assay, qRT-PCR, Western blot	22020335
MIRT006825	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR	22912877
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT006825	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT006840	hsa-miR-370-3p	GFP reporter assay, LacZ reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	21666718
MIRT016729	hsa-miR-335-5p	Microarray	18185580
MIRT020143	hsa-miR-130b-3p	Sequencing, PAR-CLIP	20371350
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT020143	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT027974	hsa-miR-93-5p	Sequencing, PAR-CLIP	20371350
MIRT027974	hsa-miR-93-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24606633
MIRT027974	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT027974	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT027974	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT053287	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22336710
MIRT053287	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT053301	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	22020335
MIRT053301	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	25980442
MIRT053652	hsa-miR-145-5p	Microarray	22942087
MIRT053652	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23986572
MIRT053652	hsa-miR-145-5p	qRT-PCR, Luciferase reporter assay, Immunoblot, Western blot	25323858
MIRT053652	hsa-miR-145-5p	Luciferase reporter assay	27388239
MIRT053735	hsa-miR-630	Microarray	22942087
MIRT054452	hsa-miR-211-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24039954
MIRT054486	hsa-miR-655-3p	Luciferase reporter assay/Western blot, qRT-PCR	23690952
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT091687	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT091687	hsa-miR-130a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27304191
MIRT091688	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT091688	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT091688	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT091688	hsa-miR-142-5p	Luciferase reporter assay, qRT-PCR, Western blot	26572508
MIRT091689	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT091689	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT091690	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT091691	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT091691	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT091692	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT091692	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT091693	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT091694	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT091694	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT091695	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT091695	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT091697	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT091697	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT091699	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT091699	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT091700	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT091700	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT091700	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT091701	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT091702	hsa-miR-4295	PAR-CLIP	22012620
MIRT091702	hsa-miR-4295	PAR-CLIP	21572407
MIRT091702	hsa-miR-4295	PAR-CLIP	20371350
MIRT091703	hsa-miR-3666	PAR-CLIP	22012620
MIRT091703	hsa-miR-3666	PAR-CLIP	21572407
MIRT091703	hsa-miR-3666	PAR-CLIP	20371350
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT091704	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT091712	hsa-miR-1276	PAR-CLIP	23592263
MIRT091712	hsa-miR-1276	PAR-CLIP	22012620
MIRT162313	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT162322	hsa-miR-551b-5p	PAR-CLIP	20371350
MIRT162323	hsa-miR-1200	PAR-CLIP	21572407
MIRT162326	hsa-miR-544b	PAR-CLIP	21572407
MIRT162333	hsa-miR-5095	PAR-CLIP	22012620
MIRT162333	hsa-miR-5095	PAR-CLIP	21572407
MIRT162335	hsa-miR-6758-3p	PAR-CLIP	21572407
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	22012620
MIRT162337	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT243467	hsa-miR-33a-3p	PAR-CLIP	23592263
MIRT243467	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT243468	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT243469	hsa-miR-610	PAR-CLIP	23592263
MIRT243469	hsa-miR-610	PAR-CLIP	22012620
MIRT243470	hsa-miR-3978	PAR-CLIP	22012620
MIRT307002	hsa-miR-940	PAR-CLIP	22012620
MIRT307008	hsa-miR-6808-5p	PAR-CLIP	22012620
MIRT307010	hsa-miR-6893-5p	PAR-CLIP	22012620
MIRT307050	hsa-miR-34a-5p	PAR-CLIP	22012620
MIRT307051	hsa-miR-34c-5p	PAR-CLIP	22012620
MIRT307052	hsa-miR-449a	PAR-CLIP	22012620
MIRT307053	hsa-miR-449b-5p	PAR-CLIP	22012620
MIRT307054	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT307055	hsa-miR-1253	PAR-CLIP	23592263
MIRT307056	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT307057	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT307058	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT307059	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT307060	hsa-miR-6806-5p	PAR-CLIP	22012620
MIRT370849	hsa-miR-1827	PAR-CLIP	23592263
MIRT370850	hsa-miR-4316	PAR-CLIP	23592263
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR	25024357
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756824
MIRT438536	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26315535
MIRT438536	hsa-miR-9-5p	qRT-PCR, Western blot	27274768
MIRT466405	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT466405	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT466406	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT466406	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT466407	hsa-miR-595	PAR-CLIP	23592263
MIRT533835	hsa-miR-4438	PAR-CLIP	22012620
MIRT533835	hsa-miR-4438	PAR-CLIP	21572407
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT533836	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT533837	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT533838	hsa-miR-3609	PAR-CLIP	22012620
MIRT533838	hsa-miR-3609	PAR-CLIP	21572407
MIRT533838	hsa-miR-3609	PAR-CLIP	20371350
MIRT553662	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT553663	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT553664	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT553665	hsa-miR-4324	PAR-CLIP	21572407
MIRT608129	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608129	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608130	hsa-miR-147a	HITS-CLIP	24906430
MIRT608130	hsa-miR-147a	HITS-CLIP	27418678
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608131	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608132	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608132	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608133	hsa-miR-4732-5p	HITS-CLIP	24906430
MIRT608133	hsa-miR-4732-5p	HITS-CLIP	27418678
MIRT608134	hsa-miR-6832-5p	HITS-CLIP	24906430
MIRT608134	hsa-miR-6832-5p	HITS-CLIP	27418678
MIRT608135	hsa-miR-6856-5p	HITS-CLIP	24906430
MIRT608135	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT608136	hsa-miR-6758-5p	HITS-CLIP	24906430
MIRT608136	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT712126	hsa-miR-488-3p	HITS-CLIP	19536157
MIRT712127	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT712128	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT712129	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT712130	hsa-miR-7161-5p	HITS-CLIP	19536157
MIRT712131	hsa-miR-548u	HITS-CLIP	19536157
MIRT717786	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT717787	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT717788	hsa-miR-7162-3p	HITS-CLIP	19536157
MIRT717789	hsa-miR-4649-3p	HITS-CLIP	19536157
MIRT717790	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT717791	hsa-miR-3200-5p	HITS-CLIP	19536157
MIRT717792	hsa-miR-7849-3p	HITS-CLIP	19536157
MIRT717793	hsa-miR-606	HITS-CLIP	19536157
MIRT717794	hsa-miR-570-3p	HITS-CLIP	19536157
MIRT717795	hsa-miR-5688	HITS-CLIP	19536157
MIRT717796	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT732972	hsa-miR-196a-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26940097
MIRT732973	hsa-miR-196b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26940097
MIRT733037	hsa-miR-202-5p	Luciferase reporter assay, Western blot	28373289
MIRT734925	hsa-miR-181c-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26682928
MIRT735049	hsa-miR-520a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	28184932
MIRT735097	hsa-miR-23b-5p	Luciferase reporter assay	27388239
MIRT735114	hsa-miR-302d-3p	Luciferase reporter assay, qRT-PCR, Western blot	28352351

Transcription factors

Show/Hide all(10)

Transcription factor	Regulation	Reference
EGR1	Unknown	10982796
ETS1	Activation	14976186
ETS1	Unknown	10508522
ETV4	Unknown	14976186
EWSR1	Repression	10508522
FLI1	Activation	10508522
FLI1	Repression	10508522
HDAC2	Repression	19088080
KLF14	Repression	19088080
SP1	Unknown	10982796;11687969

Show/Hide all(114)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001568	Process	Blood vessel development	TAS	10092230
GO:0001569	Process	Branching involved in blood vessel morphogenesis	ISS
GO:0001570	Process	Vasculogenesis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001947	Process	Heart looping	ISS
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0002651	Process	Positive regulation of tolerance induction to self antigen	ISS
GO:0002663	Process	Positive regulation of B cell tolerance induction	ISS
GO:0002666	Process	Positive regulation of T cell tolerance induction	ISS
GO:0003148	Process	Outflow tract septum morphogenesis	ISS
GO:0003149	Process	Membranous septum morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003181	Process	Atrioventricular valve morphogenesis	ISS
GO:0003186	Process	Tricuspid valve morphogenesis	ISS
GO:0003214	Process	Cardiac left ventricle morphogenesis	ISS
GO:0003274	Process	Endocardial cushion fusion	ISS
GO:0003430	Process	Growth plate cartilage chondrocyte growth	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004675	Function	Transmembrane receptor protein serine/threonine kinase activity	IDA	12015308
GO:0005024	Function	Transforming growth factor beta-activated receptor activity	IBA	21873635
GO:0005024	Function	Transforming growth factor beta-activated receptor activity	IC	1326540
GO:0005024	Function	Transforming growth factor beta-activated receptor activity	IDA	7852346, 18453574
GO:0005024	Function	Transforming growth factor beta-activated receptor activity	IMP	1333888
GO:0005026	Function	Transforming growth factor beta receptor activity, type II	IEA
GO:0005515	Function	Protein binding	IPI	7852346, 8242742, 8555189, 8622651, 9865696, 11278302, 11279102, 11483955, 11850637, 12015308, 15702480, 16530041, 18243111, 20856203, 20860622, 21054789, 21423151, 21441952, 23178117, 24263861, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	IDA	7852346
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	25893292
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IEA
GO:0005901	Component	Caveola	IDA	17878231
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	12015308
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006915	Process	Apoptotic process	IDA	17471240
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA	21873635
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IC	1326540
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	18453574
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	1333888
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007182	Process	Common-partner SMAD protein phosphorylation	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007420	Process	Brain development	ISS
GO:0007507	Process	Heart development	IBA	21873635
GO:0007507	Process	Heart development	ISS
GO:0007566	Process	Embryo implantation	IEA
GO:0007568	Process	Aging	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7761852
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009897	Component	External side of plasma membrane	IDA	18453574
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	26459119
GO:0016021	Component	Integral component of membrane	IDA	7852346
GO:0017002	Function	Activin-activated receptor activity	IBA	21873635
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	12015308
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	12015308
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IEA
GO:0032147	Process	Activation of protein kinase activity	ISS
GO:0032924	Process	Activin receptor signaling pathway	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IBA	21873635
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	1333888
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0042060	Process	Wound healing	IEA
GO:0042127	Process	Regulation of cell population proliferation	ISS
GO:0042493	Process	Response to drug	IDA	17878231
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043235	Component	Receptor complex	IDA	7852346, 8774881
GO:0043415	Process	Positive regulation of skeletal muscle tissue regeneration	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045121	Component	Membrane raft	IDA	25893292
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0046332	Function	SMAD binding	IBA	21873635
GO:0046332	Function	SMAD binding	IDA	11157754, 18453574
GO:0046872	Function	Metal ion binding	IEA
GO:0048185	Function	Activin binding	IBA	21873635
GO:0048545	Process	Response to steroid hormone	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	ISS
GO:0050431	Function	Transforming growth factor beta binding	IBA	21873635
GO:0050431	Function	Transforming growth factor beta binding	IDA	7852346, 18243111, 18453574
GO:0050431	Function	Transforming growth factor beta binding	IPI	1326540, 1333888
GO:0050431	Function	Transforming growth factor beta binding	IPI	7852346
GO:0051138	Process	Positive regulation of NK T cell differentiation	ISS
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0060389	Process	Pathway-restricted SMAD protein phosphorylation	IDA	18453574
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060434	Process	Bronchus morphogenesis	IEA
GO:0060440	Process	Trachea formation	IEA
GO:0060443	Process	Mammary gland morphogenesis	IEA
GO:0060463	Process	Lung lobe morphogenesis	IEA
GO:0062009	Process	Secondary palate development	ISS
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0071363	Process	Cellular response to growth factor stimulus	IBA	21873635
GO:1905007	Process	Positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905315	Process	Cell proliferation involved in endocardial cushion morphogenesis	ISS
GO:1905316	Process	Superior endocardial cushion morphogenesis	ISS
GO:1905317	Process	Inferior endocardial cushion morphogenesis	ISS
GO:1990086	Process	Lens fiber cell apoptotic process	IEA
GO:1990428	Process	MiRNA transport	ISS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IMP	20160708
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	17164348

MIM	HGNC	e!Ensembl
190182	11773	ENSG00000163513

Protein

UniProt ID

P37173

Protein name

TGF-beta receptor type-2 (TGFR-2) (EC 2.7.11.30) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II)

Protein function

Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.

PDB

1KTZ , 1M9Z , 1PLO , 2PJY , 3KFD , 4P7U , 4XJJ , 5E8V , 5E8Y , 5E91 , 5E92 , 5QIN , 5TX4 , 5TY4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08917	ecTbetaR2	49 → 159	Transforming growth factor beta receptor 2 ectodomain	Domain
PF07714	PK_Tyr_Ser-Thr	244 → 538	Protein tyrosine and serine/threonine kinase	Domain

Sequence

MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK

Sequence length

567

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412