TGFB1 (transforming growth factor beta 1)

Gene

• Entrez ID: 7040
• Gene name: Transforming growth factor beta 1
• Gene symbol: TGFB1
• Synonyms: CED, DPD1, IBDIMDE, LAP, TGF-beta1, TGFB, TGFbeta
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease. [provided by RefSeq, Aug 2016]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800470	G>A,C	Risk-factor, benign	Coding sequence variant, missense variant
rs72480429	G>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs104894719	A>G	Pathogenic	Coding sequence variant, missense variant
rs104894720	C>T	Pathogenic	Coding sequence variant, missense variant
rs104894721	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894722	A>C,G,T	Pathogenic	Coding sequence variant, missense variant
rs111033611	A>G	Pathogenic	Coding sequence variant, missense variant
rs200164212	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs200482214	G>A	Pathogenic	Missense variant, coding sequence variant
rs281865483	->AGCAGCAGC	Pathogenic	Coding sequence variant, inframe insertion
rs281865484	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs281865485	G>C	Pathogenic	Missense variant, coding sequence variant
rs1057521741	G>C	Likely-pathogenic	Coding sequence variant, stop gained
rs1336387628	A>C,G,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs1555755242	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1555755308	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1599893542	T>C	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005918	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20945401
MIRT006059	hsa-miR-29b-3p	ELISA, GFP reporter assay, qRT-PCR	21273536
MIRT006059	hsa-miR-29b-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27895107
MIRT006114	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	21991303
MIRT006499	hsa-miR-633	Luciferase reporter assay	20637737
MIRT006791	hsa-miR-663a	Luciferase reporter assay, Western blot	22393947
MIRT006791	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	27624777
MIRT030730	hsa-miR-21-5p	Microarray	18591254
MIRT030730	hsa-miR-21-5p	ELISA, qRT-PCR	26383248
MIRT037719	hsa-miR-744-5p	CLASH	23622248
MIRT053337	hsa-miR-211-5p	Luciferase reporter assay, qRT-PCR, Western blot	23726841
MIRT437865	hsa-miR-17-5p	qRT-PCR	23433743
MIRT437866	hsa-miR-19b-3p	qRT-PCR	23433743
MIRT438039	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438040	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438206	hsa-miR-122-5p	qRT-PCR	24168656
MIRT438749	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT731900	hsa-miR-422a	Luciferase reporter assay, qRT-PCR, Western blot	27779704
MIRT732759	hsa-miR-590-5p	qRT-PCR	26498065
MIRT733115	hsa-miR-675-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26417995
MIRT733231	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28337286
MIRT733732	hsa-miR-574-3p	Luciferase reporter assay, qRT-PCR, Western blot	28042090
MIRT733875	hsa-miR-15b-5p	Western blot	27499071
MIRT733892	hsa-miR-29b-1-5p	qRT-PCR, Western blot	27273381
MIRT734164	hsa-miR-106a-5p	qRT-PCR	25950430
MIRT734995	hsa-miR-185-5p	Luciferase reporter assay	28259900

Transcription factors

Transcription factor	Regulation	Reference
ASH1L	Unknown	22488473
FOSB	Unknown	10843986
FOSL2	Unknown	10843986
JUND	Unknown	10843986
NFKB1	Unknown	16365456
SMAD3	Repression	19214138
SMAD4	Unknown	21968601
SMAD7	Activation	19214138
SP1	Activation	9580699
SP1	Unknown	22415074;2808430
STAT3	Activation	16474852
USF1	Activation	14757763
USF2	Activation	14757763
USF2	Unknown	15184388

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IMP	21147091
GO:0001570	Process	Vasculogenesis	ISS
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	25893292, 29529050
GO:0001843	Process	Neural tube closure	ISS
GO:0001933	Process	Negative regulation of protein phosphorylation	IDA	8053900
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18625725, 21145499
GO:0002062	Process	Chondrocyte differentiation	IDA	15040835
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IDA	15451575
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	TAS	9639571
GO:0002576	Process	Platelet degranulation	TAS
GO:0003179	Process	Heart valve morphogenesis	ISS
GO:0003180	Process	Aortic valve morphogenesis	IMP	26634652
GO:0003823	Function	Antigen binding	IPI	16754747
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IBA	21873635
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IDA	11157754
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IMP	8167376
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IPI	1333888
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	TAS	24263861
GO:0005515	Function	Protein binding	IPI	1326540, 2022183, 2119582, 7852346, 8370410, 8617200, 10092230, 10746731, 10885742, 10930463, 11157754, 15247411, 15864306, 17827158, 18672106, 19651619, 20505824, 20856203, 20860622, 21054789, 21441952, 21677751, 25241761, 25416956, 25548275, 27339457, 28514442, 29909984, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	19734317
GO:0005634	Component	Nucleus	IDA	18040277
GO:0005737	Component	Cytoplasm	IDA	18040277
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	19366691
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006611	Process	Protein export from nucleus	IDA	9770491, 17438144, 18588859
GO:0006754	Process	ATP biosynthetic process	IDA	10513816
GO:0006796	Process	Phosphate-containing compound metabolic process	IDA	10513816
GO:0006954	Process	Inflammatory response	IDA	21147091
GO:0007050	Process	Cell cycle arrest	IDA	14555988
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	18625725
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA	21873635
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9389648, 11157754
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007182	Process	Common-partner SMAD protein phosphorylation	IDA	20573232
GO:0007183	Process	SMAD protein complex assembly	IDA	17438144
GO:0007435	Process	Salivary gland morphogenesis	IEP	18080134
GO:0007507	Process	Heart development	ISS
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10513816, 14633705
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26169693
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15334054
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	11158066
GO:0009611	Process	Response to wounding	IEP	18040277
GO:0009986	Component	Cell surface	IMP	19366691
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	TAS	19506300
GO:0010628	Process	Positive regulation of gene expression	IDA	18625725, 18832382, 18941241, 19913496, 25322725, 26634652, 26687115, 27162619, 29167509
GO:0010628	Process	Positive regulation of gene expression	IGI	22269326
GO:0010628	Process	Positive regulation of gene expression	IMP	26169693
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	19913496, 20067797, 22269326, 25163461, 26634652, 29167509, 29529050
GO:0010629	Process	Negative regulation of gene expression	IGI	22269326
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IC	22269326
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	17999987, 18505915
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	NAS	21319131
GO:0010742	Process	Macrophage derived foam cell differentiation	IC	15219857
GO:0010763	Process	Positive regulation of fibroblast migration	IDA	18555217
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IDA	18625725, 19736306
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	21873635
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	9389648, 19736306, 26634652
GO:0010936	Process	Negative regulation of macrophage cytokine production	IDA	20875417
GO:0014008	Process	Positive regulation of microglia differentiation	ISS
GO:0016202	Process	Regulation of striated muscle tissue development	ISS
GO:0016477	Process	Cell migration	IDA	25893292
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IDA	15334054
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019899	Function	Enzyme binding	IPI	19366691
GO:0021915	Process	Neural tube development	ISS
GO:0022408	Process	Negative regulation of cell-cell adhesion	IDA	18593713
GO:0030214	Process	Hyaluronan catabolic process	IDA	17324121
GO:0030308	Process	Negative regulation of cell growth	IDA	15334054
GO:0030334	Process	Regulation of cell migration	TAS	19018011
GO:0030335	Process	Positive regulation of cell migration	IDA	19736306
GO:0030335	Process	Positive regulation of cell migration	IMP	26169693
GO:0030501	Process	Positive regulation of bone mineralization	IEP	17401695
GO:0030509	Process	BMP signaling pathway	IBA	21873635
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0031012	Component	Extracellular matrix	ISS
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031293	Process	Membrane protein intracellular domain proteolysis	IDA	25310401
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	19366691
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	21147091
GO:0032270	Process	Positive regulation of cellular protein metabolic process	IDA	15219857
GO:0032355	Process	Response to estradiol	IDA	18039789
GO:0032570	Process	Response to progesterone	IDA	18039789
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	18453574
GO:0032801	Process	Receptor catabolic process	IDA	17878231
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	22073128
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	19734317, 22269326, 25310401
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IGI	22269326
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IMP	11158066
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	18625725, 19736306
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IMP	8167376
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	10885742
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IBA	21873635
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IMP	8167376
GO:0034714	Function	Type III transforming growth factor beta receptor binding	IPI	10092230
GO:0035307	Process	Positive regulation of protein dephosphorylation	IDA	14555988
GO:0042127	Process	Regulation of cell population proliferation	IBA	21873635
GO:0042306	Process	Regulation of protein import into nucleus	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	19366691
GO:0042802	Function	Identical protein binding	IPI	21677751
GO:0043117	Process	Positive regulation of vascular permeability	IDA	21168935
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	18625725
GO:0043491	Process	Protein kinase B signaling	IMP	21147091
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IDA	18625725
GO:0043932	Process	Ossification involved in bone remodeling	IEP	17401695
GO:0045216	Process	Cell-cell junction organization	IDA	18505915
GO:0045596	Process	Negative regulation of cell differentiation	IEP	19357233
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	15040835
GO:0045662	Process	Negative regulation of myoblast differentiation	IDA	9770491
GO:0045786	Process	Negative regulation of cell cycle	IDA	11502704
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	15702480, 18832382
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	9389648, 14517293, 15334054, 16816361
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045918	Process	Negative regulation of cytolysis	IDA	24586048
GO:0045930	Process	Negative regulation of mitotic cell cycle	IDA	14555988
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18832382
GO:0048298	Process	Positive regulation of isotype switching to IgA isotypes	IDA	14988498
GO:0048535	Process	Lymph node development	ISS
GO:0048642	Process	Negative regulation of skeletal muscle tissue development	IDA	9770491
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	9950587
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IMP	16943770
GO:0050714	Process	Positive regulation of protein secretion	IDA	18505915
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	21168935
GO:0050900	Process	Leukocyte migration	TAS
GO:0050921	Process	Positive regulation of chemotaxis	IDA	18555217
GO:0051098	Process	Regulation of binding	ISS
GO:0051101	Process	Regulation of DNA binding	ISS
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	18625725
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0060312	Process	Regulation of blood vessel remodeling	IC	22269326
GO:0060312	Process	Regulation of blood vessel remodeling	NAS	22269326
GO:0060389	Process	Pathway-restricted SMAD protein phosphorylation	IDA	11157754, 17999987, 18453574, 25893292
GO:0060390	Process	Regulation of SMAD protein signal transduction	IDA	25893292
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	9389648, 19366691, 29167509
GO:0060395	Process	SMAD protein signal transduction	IBA	21873635
GO:0060965	Process	Negative regulation of gene silencing by miRNA	IGI	22269326
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	23979707
GO:0070168	Process	Negative regulation of biomineral tissue development	IDA	26634652
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	25310401
GO:0070723	Process	Response to cholesterol	IDA	17878231
GO:0071407	Process	Cellular response to organic cyclic compound	IDA	21147091
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	19736306, 22269326
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IGI	22269326
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0085029	Process	Extracellular matrix assembly	IDA	19734317
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	12893825, 15040835
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	15334054
GO:1900126	Process	Negative regulation of hyaluronan biosynthetic process	IDA	17324121
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26634652
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IC	22269326
GO:1901666	Process	Positive regulation of NAD+ ADP-ribosyltransferase activity	IDA	22073128
GO:1902893	Process	Regulation of pri-miRNA transcription by RNA polymerase II	IMP	18548003
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	26311719, 26493107
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IDA	21168935, 24586048
GO:1903799	Process	Negative regulation of production of miRNAs involved in gene silencing by miRNA	IGI	22269326
GO:1903800	Process	Positive regulation of production of miRNAs involved in gene silencing by miRNA	IDA	18548003
GO:1905005	Process	Regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:1905313	Process	Transforming growth factor beta receptor signaling pathway involved in heart development	ISS
GO:1990402	Process	Embryonic liver development	ISS
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IDA	22073128
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IDA	25163461

Other IDs

• MIM: 190180
• HGNC: 11766
• e!Ensembl: ENSG00000105329

Protein

• UniProt ID: P01137
• Protein name: Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide (LAP); Transforming growth factor beta-1 (TGF-beta-1)]
• Protein function: Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively. ; [Latency-associated peptide]: Required to maintain the Transforming growth factor beta-1 (TGF-beta-1) chain in a latent state during storage in extracellular matrix (PubMed:28117447). Associates non-covalently with TGF-beta-1 and regulates its activation via interaction with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS, that control activation of TGF-beta-1 (PubMed:2022183, PubMed:8617200, PubMed:8939931, PubMed:19750484, PubMed:22278742, PubMed:19651619). Interaction with LRRC33/NRROS regulates activation of TGF-beta-1 in macrophages and microglia (Probable). Interaction with LRRC32/GARP controls activation of TGF-beta-1 on the surface of activated regulatory T-cells (Tregs) (PubMed:19750484, PubMed:22278742, PubMed:19651619). Interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-1 (PubMed:22278742, PubMed:28117447). ; [Transforming growth factor beta-1]: Multifunctional protein that regulates the growth and differentiation of various cell types and is involved in various processes, such as normal development, immune function, microglia function and responses to neurodegeneration (By similarity). Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains remain non-covalently linked rendering TGF-beta-1 inactive during storage in extracellular matrix (PubMed:29109152). At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS that control activation of TGF-beta-1 and maintain it in a latent state during storage in extracellular milieus (PubMed:2022183, PubMed:8617200, PubMed:8939931, PubMed:19750484, PubMed:22278742, PubMed:19651619). TGF-beta-1 is released from LAP by integrins (ITGAV:ITGB6 or ITGAV:ITGB8): integrin-binding to LAP stabilizes an alternative conformation of the LAP bowtie tail and results in distortion of the LAP chain and subsequent release of the active TGF-beta-1 (PubMed:22278742, PubMed:28117447). Once activated following release of LAP, TGF-beta-1 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal (PubMed:20207738). While expressed by many cells types, TGF-beta-1 only has a very localized range of action within cell environment thanks to fine regulation of its activation by Latency-associated peptide chain (LAP) and 'milieu molecules' (By similarity). Plays an important role in bone remodeling: acts as a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner (By similarity). At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development (By similarity). At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (PubMed:25310401). Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (PubMed:25893292, PubMed:29483653, PubMed:30696809). Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (PubMed:25893292, PubMed:30696809).
• PDB: 1KLA, 1KLC, 1KLD, 3KFD, 4KV5, 5FFO, 5VQP, 6OM2, 6P7J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00688	TGFb_propeptide	29 → 261	TGF-beta propeptide	Family
  PF00019	TGF_beta	292 → 389	Transforming growth factor beta like domain	Domain

• Sequence:

  MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
  SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
  YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
  YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
  TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
  DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
  LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

• Sequence length: 390