TCF7L1 (transcription factor 7 like 1)

Gene

• Entrez ID: 83439
• Gene name: Transcription factor 7 like 1
• Gene symbol: TCF7L1
• Synonyms: TCF-3, TCF3
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence. [provided by RefSeq, Nov 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016640	hsa-miR-429	Reporter assay	20005803
MIRT020351	hsa-miR-200a-3p	Reporter assay	20005803
MIRT021073	hsa-miR-200c-3p	Reporter assay	20005803
MIRT021652	hsa-miR-141-3p	Reporter assay	20005803
MIRT024127	hsa-miR-200b-3p	Reporter assay	20005803

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0003677	Function	DNA binding	NAS	1741298, 11085512
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1741298, 11085512
GO:0005634	Component	Nucleus	NAS	1741298, 11085512
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	NAS	1741298, 11085512
GO:0006355	Process	Regulation of transcription, DNA-templated	NAS	1741298, 11085512
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008013	Function	Beta-catenin binding	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	NAS	1741298, 11085512
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990907	Component	Beta-catenin-TCF complex	IBA	21873635

Other IDs

• MIM: 604652
• HGNC: 11640
• e!Ensembl: ENSG00000152284

Protein

• UniProt ID: Q9HCS4
• Protein name: Transcription factor 7-like 1 (HMG box transcription factor 3) (TCF-3)
• Protein function: Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. Necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis (By similarity). Down-regulates NQO1, leading to increased mitomycin c resistance.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08347	CTNNB1_binding	1 → 250	N-terminal CTNNB1 binding	Family
  PF00505	HMG_box	346 → 414	HMG (high mobility group) box	Domain

• Sequence:

  MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
  DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
  GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
  VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
  VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
  PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
  RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
  KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
  TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
  LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH

• Sequence length: 588