TCF7 (transcription factor 7)

Gene

• Entrez ID: 6932
• Gene name: Transcription factor 7
• Gene symbol: TCF7
• Synonyms: TCF-1
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innate lymphoid cell development. The encoded protein forms a complex with beta-catenin and activates transcription through a Wnt/beta-catenin signaling pathway. Mice with a knockout of this gene are viable and fertile, but display a block in T-lymphocyte differentiation. Alternative splicing results in multiple transcript variants. Naturally-occurring isoforms lacking the N-terminal beta-catenin interaction domain may act as dominant negative regulators of Wnt signaling. [provided by RefSeq, Oct 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024837	hsa-miR-215-5p	Microarray	19074876
MIRT026207	hsa-miR-192-5p	Microarray	19074876
MIRT731117	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Immunohistochemistry, Western blot	25436980
MIRT731389	hsa-miR-22-3p	, Luciferase reporter assay, qRT-PCR, Western blot	26193896

Transcription factors

Transcription factor	Regulation	Reference
CTNNB1	Unknown	17724465

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	18579517, 20128911
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001217	Function	DNA-binding transcription repressor activity	ISS
GO:0005515	Function	Protein binding	IPI	9783587, 16442529, 17218525, 17510365, 19358846, 20028982, 25678599, 26079538
GO:0005634	Component	Nucleus	IDA	18579517
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006955	Process	Immune response	TAS	1569101
GO:0008013	Function	Beta-catenin binding	IDA	9488439
GO:0016604	Component	Nuclear body	IDA
GO:0033153	Process	T cell receptor V(D)J recombination	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	ISS
GO:0045586	Process	Regulation of gamma-delta T cell differentiation	ISS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0071353	Process	Cellular response to interleukin-4	IDA	18579517
GO:1904837	Process	Beta-catenin-TCF complex assembly	TAS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990907	Component	Beta-catenin-TCF complex	IBA	21873635

Other IDs

• MIM: 189908
• HGNC: 11639
• e!Ensembl: ENSG00000081059

Protein

• UniProt ID: P36402
• Protein name: Transcription factor 7 (TCF-7) (T-cell-specific transcription factor 1) (T-cell factor 1) (TCF-1)
• Protein function: Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T-lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. Represses expression of the T-cell receptor gamma gene in alpha-beta T-cell lineages (By similarity). Required for the development of natural killer receptor-positive lymphoid tissue inducer T-cells (By similarity). TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7 and CTNNB1.May also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08347	CTNNB1_binding	1 → 212	N-terminal CTNNB1 binding	Family
  PF00505	HMG_box	269 → 337	HMG (high mobility group) box	Domain

• Sequence:

  MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
  GAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKET
  VYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQ
  KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPS
  GKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAIN
  QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTET
  NWPRELKDGNGQESLSMSSSSSPA

• Sequence length: 384