TAB3 (TGF-beta activated kinase 1 (MAP3K7) binding protein 3)

Gene

• Entrez ID: 257397
• Gene name: TGF-beta activated kinase 1 (MAP3K7) binding protein 3
• Gene symbol: TAB3
• Synonyms: MAP3K7IP3, NAP1
• Chromosome: X
• Chromosome location: Xp21.2
• Summary: The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007039	hsa-miR-23b-3p	Luciferase reporter assay	22660635
MIRT007170	hsa-miR-195-5p	Luciferase reporter assay	23487264
MIRT053429	hsa-miR-512-5p	Microarray	23807165
MIRT053683	hsa-miR-181a-5p	Microarray	22942087
MIRT053696	hsa-miR-188-5p	Microarray	22942087
MIRT495038	hsa-miR-192-3p	PAR-CLIP	23708386
MIRT495039	hsa-miR-5581-3p	PAR-CLIP	23708386
MIRT495040	hsa-miR-6872-3p	PAR-CLIP	23708386
MIRT495041	hsa-miR-1255b-2-3p	PAR-CLIP	23708386
MIRT533984	hsa-miR-4303	PAR-CLIP	22012620
MIRT533985	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT533986	hsa-miR-610	PAR-CLIP	22012620
MIRT533987	hsa-miR-1252-5p	PAR-CLIP	22012620
MIRT533988	hsa-miR-6751-3p	PAR-CLIP	22012620
MIRT533989	hsa-miR-1199-5p	PAR-CLIP	22012620
MIRT732520	hsa-miR-342-3p	qRT-PCR, Western blot	25580008
MIRT733025	hsa-miR-30a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26555189
MIRT733451	hsa-miR-892b	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26747895

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0005515	Function	Protein binding	IPI	17158449, 17449468, 21512573, 21903422, 22081109, 25416956, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007254	Process	JNK cascade	TAS
GO:0010008	Component	Endosome membrane	TAS
GO:0010507	Process	Negative regulation of autophagy	TAS	21976705
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	23487264
GO:0043130	Function	Ubiquitin binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS

Other IDs

• MIM: 300480
• HGNC: 30681
• e!Ensembl: ENSG00000157625

Protein

• UniProt ID: Q8N5C8
• Protein name: TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 3) (NF-kappa-B-activating protein 1) (TAK1-binding protein 3) (TAB-3) (TGF-beta-activated kinase 1-binding protein 3)
• Protein function: Adapter required to activate the JNK and NF-kappa-B signaling pathways through the specific recognition of 'Lys-63'-linked polyubiquitin chains by its RanBP2-type zinc finger (NZF) (PubMed:14633987, PubMed:14766965, PubMed:15327770, PubMed:22158122). Acts as an adapter linking MAP3K7/TAK1 and TRAF6 to 'Lys-63'-linked polyubiquitin chains (PubMed:14633987, PubMed:14766965, PubMed:15327770, PubMed:22158122). The RanBP2-type zinc finger (NZF) specifically recognizes Lys-63'-linked polyubiquitin chains unanchored or anchored to the substrate proteins such as RIPK1/RIP1: this acts as a scaffold to organize a large signaling complex to promote autophosphorylation of MAP3K7/TAK1, and subsequent activation of I-kappa-B-kinase (IKK) core complex by MAP3K7/TAK1 (PubMed:15327770, PubMed:22158122). ; [Isoform 2]: May be an oncogenic factor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02845	CUE	9 → 50	CUE domain	Domain

• Sequence:

  MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
  PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
  VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
  PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
  GRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
  PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSK
  GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
  PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
  EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
  ERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
  RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
  AADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT

• Sequence length: 712