STAT3 (signal transducer and activator of transcription 3)

Gene

• Entrez ID: 6774
• Gene name: Signal transducer and activator of transcription 3
• Gene symbol: STAT3
• Synonyms: ADMIO, ADMIO1, APRF, HIES
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. [provided by RefSeq, Aug 2020]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs113994135	G>A	Pathogenic	Coding sequence variant, missense variant
rs113994136	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs113994137	C>T	Pathogenic	Coding sequence variant, missense variant
rs113994138	CAC>-	Pathogenic	Coding sequence variant, inframe deletion
rs113994139	C>T	Pathogenic	Coding sequence variant, missense variant
rs193922716	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs193922717	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs193922719	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs193922720	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs193922721	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs193922722	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs397514766	G>A	Pathogenic	Coding sequence variant, missense variant
rs574370336	G>C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs587777648	T>C	Pathogenic	Coding sequence variant, missense variant
rs587777649	G>A,C	Pathogenic	Coding sequence variant, missense variant, synonymous variant
rs587777650	C>G	Pathogenic	Coding sequence variant, missense variant
rs769031989	T>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs786205503	C>A	Likely-pathogenic	Missense variant, coding sequence variant
rs869312887	C>G	Pathogenic	Missense variant, coding sequence variant
rs869312888	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs869312889	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs869312890	G>A	Pathogenic	Missense variant, coding sequence variant
rs869312891	C>A	Pathogenic	Missense variant, coding sequence variant
rs869312892	G>A	Pathogenic	Missense variant, coding sequence variant, intron variant
rs869312893	A>C	Pathogenic	Missense variant, coding sequence variant
rs869312894	C>T	Pathogenic	Missense variant, coding sequence variant
rs886039434	A>G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs886039546	T>C	Pathogenic	Missense variant, coding sequence variant
rs1057520377	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057521091	T>C,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064793452	CCGT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064794421	ATA>CTG	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794899	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794957	G>A,C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064796762	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064796922	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307931	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691377	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691476	A>G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1131691937	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555562364	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555563717	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555563854	G>C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1555563871	C>T	Pathogenic	Coding sequence variant, missense variant
rs1555565595	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555566820	A>C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1555568535	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1567708034	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1567713850	T>A	Pathogenic	Coding sequence variant, missense variant
rs1598381121	A>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598381169	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598393453	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598399795	G>T	Pathogenic	Missense variant, coding sequence variant
rs1598406623	C>A	Pathogenic	Splice donor variant
rs1598406651	C>T	Likely-pathogenic	Splice acceptor variant
rs1598423756	C>T	Likely-pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000497	hsa-miR-20b-5p	qRT-PCR, ELISA, ChIP, Western blot	20232316
MIRT000497	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT005006	hsa-miR-125b-5p	Microarray	17891175
MIRT005006	hsa-miR-125b-5p	Western blot	28108732
MIRT005006	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	27576314
MIRT006959	hsa-miR-337-3p	Luciferase reporter assay, qRT-PCR, Western blot	22723956
MIRT021003	hsa-miR-155-5p	Proteomics	18668040
MIRT028178	hsa-miR-93-5p	Sequencing	20371350
MIRT028178	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT031079	hsa-miR-21-5p	Western blot;Other	20048743
MIRT031079	hsa-miR-21-5p	Microarray	18591254
MIRT031079	hsa-miR-21-5p	ELISA, qRT-PCR, Western blot	23998932
MIRT031079	hsa-miR-21-5p	Western blot	26549725
MIRT049359	hsa-miR-92a-3p	CLASH	23622248
MIRT049359	hsa-miR-92a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23820254
MIRT050559	hsa-miR-20a-5p	CLASH	23622248
MIRT050559	hsa-miR-20a-5p	qRT-PCR, Western blot	23836497
MIRT050559	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT050559	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23059786
MIRT051593	hsa-let-7e-5p	CLASH	23622248
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24287565
MIRT052931	hsa-miR-124-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Western blot	24211205
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, immunostaining, Western blotting	23940556
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23856509
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26993295
MIRT052931	hsa-miR-124-3p	Flow, qRT-PCR, Western blot	26109806
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26707908
MIRT052931	hsa-miR-124-3p	ELISA, Flow, qRT-PCR, Western blot	27824145
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	25928665
MIRT053071	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24040078
MIRT053071	hsa-miR-130b-3p	qRT-PCR, Western blot	26475357
MIRT053229	hsa-miR-106a-5p	qRT-PCR, Western blot	23836497
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assay	23399684
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27325313
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25307786
MIRT054144	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT054144	hsa-miR-106b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26956882
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27325313
MIRT054273	hsa-miR-874-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25596740
MIRT054631	hsa-miR-4516	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24610393
MIRT054903	hsa-miR-17-5p	Immunoblot, Luciferase reporter assay	25594054
MIRT054903	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT054903	hsa-miR-17-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23059786
MIRT145857	hsa-miR-200a-3p	qRT-PCR	26535690
MIRT386936	hsa-miR-544a	Luciferase reporter assay, qRT-PCR, Western blot	27186677
MIRT438217	hsa-miR-181a-5p	qRT-PCR, Western blot	24329418
MIRT438669	hsa-miR-1234-3p	Microarray, qRT-PCR, Western blot	23841503
MIRT438928	hsa-miR-1181	Flow, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	25444909
MIRT466950	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT466951	hsa-miR-5681a	PAR-CLIP	23592263
MIRT466952	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT466953	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT466954	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT466955	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT466956	hsa-miR-4270	PAR-CLIP	23592263
MIRT466957	hsa-miR-4441	PAR-CLIP	23592263
MIRT466958	hsa-miR-922	PAR-CLIP	23592263
MIRT466959	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT466960	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT466961	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT492162	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT492163	hsa-miR-6833-3p	PAR-CLIP	23592263
MIRT492164	hsa-miR-4768-5p	PAR-CLIP	23592263
MIRT492165	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT492166	hsa-miR-7158-5p	PAR-CLIP	23592263
MIRT492167	hsa-miR-4684-5p	PAR-CLIP	23592263
MIRT492168	hsa-miR-138-2-3p	PAR-CLIP	23592263
MIRT492169	hsa-miR-371b-3p	PAR-CLIP	23592263
MIRT492170	hsa-miR-548n	PAR-CLIP	23592263
MIRT642424	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT642425	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT642426	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT642427	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT642428	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT642429	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642430	hsa-miR-618	HITS-CLIP	23824327
MIRT666063	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT666064	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT666065	hsa-miR-6762-3p	HITS-CLIP	23824327
MIRT666066	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT666067	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT679673	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT679674	hsa-miR-5095	HITS-CLIP	23824327
MIRT679675	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679676	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679677	hsa-miR-8052	HITS-CLIP	23824327
MIRT679678	hsa-miR-3199	HITS-CLIP	23824327
MIRT679679	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679680	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT679681	hsa-miR-4438	HITS-CLIP	23824327
MIRT726433	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT726433	hsa-miR-519d-3p	Luciferase reporter assay, qRT-PCR, Western blot	26238950
MIRT731450	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	28112380
MIRT731625	hsa-miR-125a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Immunohistochemistry	26389681
MIRT731935	hsa-miR-21-3p	Luciferase reporter assay, qRT-PCR, Western blot	27895788
MIRT732189	hsa-miR-519a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26970980
MIRT732362	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28280370
MIRT732553	hsa-miR-223-3p	qRT-PCR, Western blot	26348153
MIRT732605	hsa-let-7c-5p	Luciferase reporter assay	26851791
MIRT732849	hsa-miR-29b-1-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	28122338
MIRT732901	hsa-miR-23a-3p	Immunofluorescence, Luciferase reporter assay, Western blot	26314966
MIRT733906	hsa-miR-323a-3p	qRT-PCR	27059796
MIRT734093	hsa-miR-375	Western blot	28186962
MIRT734340	hsa-miR-124-5p	Luciferase reporter assay, Western blot	27977009
MIRT734340	hsa-miR-124-5p	Luciferase reporter assay, qRT-PCR, Western blot	27498908
MIRT734349	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot, Immunohistochemistry	26175849
MIRT734721	hsa-let-7a-5p	qRT-PCR, Western blot	27932893
MIRT735102	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	28413603
MIRT735428	hsa-miR-410-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	27351906

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Unknown	17951530
BRCA1	Unknown	11163768
CEBPA	Unknown	24429361
HDAC1	Unknown	18611949
HIC1	Activation	24067369
HIF1A	Unknown	23991099
KAT5	Repression	12551922
PIAS3	Unknown	16098628
RELA	Unknown	25040843
SPI1	Unknown	24429361
STAT1	Unknown	22693070
TCF7L2	Unknown	18602747
TP53	Repression	11809683
ZNF382	Repression	20682794

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8675499
GO:0000785	Component	Chromatin	IDA	16835372
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	17324931
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19390056
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001103	Function	RNA polymerase II repressing transcription factor binding	IPI	22783022
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16835372
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16946298
GO:0001659	Process	Temperature homeostasis	ISS
GO:0001754	Process	Eye photoreceptor cell differentiation	ISS
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IDA	17344214
GO:0003700	Function	DNA-binding transcription factor activity	IGI	31886314
GO:0004879	Function	Nuclear receptor activity	IDA	17324931
GO:0005515	Function	Protein binding	IPI	8662591, 9864141, 10688651, 11536047, 11585385, 11940572, 11970898, 12867595, 14966128, 15286705, 15657067, 15764709, 15821101, 15998644, 16273093, 16306601, 16331268, 16364321, 16531398, 16568091, 18200042, 18234692, 18330356, 19345327, 19372587, 20133729, 20826784, 20871632, 20876
GO:0005634	Component	Nucleus	IDA	12444102, 17324931, 17360477, 18234692, 22783022, 24846175, 28065600, 31899195
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	24429361
GO:0005737	Component	Cytoplasm	IDA	17360477, 18234692, 22783022, 31899195
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	ISS
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	15664994, 17344214
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006606	Process	Protein import into nucleus	IDA	18234692
GO:0006952	Process	Defense response	IBA	21873635
GO:0006954	Process	Inflammatory response	ISS
GO:0007165	Process	Signal transduction	TAS	7512451, 10205054
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	TAS	15664994
GO:0007399	Process	Nervous system development	TAS	10205054
GO:0008134	Function	Transcription factor binding	IPI	15664994, 24429361
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0010628	Process	Positive regulation of gene expression	IDA	23820254
GO:0010628	Process	Positive regulation of gene expression	IMP	24255059
GO:0016032	Process	Viral process	IEA
GO:0016310	Process	Phosphorylation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15664994
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	ISS
GO:0019903	Function	Protein phosphatase binding	IPI	12359225, 17360477
GO:0019953	Process	Sexual reproduction	ISS
GO:0030335	Process	Positive regulation of cell migration	IMP	24846175
GO:0030522	Process	Intracellular receptor signaling pathway	IDA	17324931
GO:0031490	Function	Chromatin DNA binding	IDA	17344214
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	31886314
GO:0032733	Process	Positive regulation of interleukin-10 production	IGI	31886314
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	31886314
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IGI	31886314
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0033210	Process	Leptin-mediated signaling pathway	IBA	21873635
GO:0033210	Process	Leptin-mediated signaling pathway	IDA	17344214
GO:0035019	Process	Somatic stem cell population maintenance	TAS
GO:0035723	Process	Interleukin-15-mediated signaling pathway	TAS
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0038113	Process	Interleukin-9-mediated signaling pathway	TAS
GO:0038114	Process	Interleukin-21-mediated signaling pathway	TAS
GO:0038155	Process	Interleukin-23-mediated signaling pathway	TAS
GO:0042127	Process	Regulation of cell population proliferation	IBA	21873635
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	TAS
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042755	Process	Eating behavior	ISS
GO:0042802	Function	Identical protein binding	IPI	7510216, 17676033, 21988832, 25609649
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043434	Process	Response to peptide hormone	IBA	21873635
GO:0044320	Process	Cellular response to leptin stimulus	IDA	17344214
GO:0044321	Process	Response to leptin	IDA	17344214
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	28283061
GO:0045747	Process	Positive regulation of Notch signaling pathway	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	19390056
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17324931, 27050391
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	19754877, 24429361, 31886314
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16835372, 16946298
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048708	Process	Astrocyte differentiation	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0051726	Process	Regulation of cell cycle	IDA	17344214
GO:0060019	Process	Radial glial cell differentiation	ISS
GO:0060259	Process	Regulation of feeding behavior	ISS
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	ISS
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	12359225, 12552091, 17324931, 24429361
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	16835372, 16946298
GO:0070102	Process	Interleukin-6-mediated signaling pathway	TAS
GO:0070106	Process	Interleukin-27-mediated signaling pathway	TAS
GO:0070757	Process	Interleukin-35-mediated signaling pathway	TAS
GO:0070878	Function	Primary miRNA binding	IGI	31507089
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0072538	Process	T-helper 17 type immune response	IDA	31899195
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IC	16835372
GO:0090575	Component	RNA polymerase II transcription regulator complex	IMP	16946298
GO:0097009	Process	Energy homeostasis	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	31886314
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	19390056, 23820254
GO:1904685	Process	Positive regulation of metalloendopeptidase activity	IGI	23820254
GO:1905618	Process	Positive regulation of miRNA mediated inhibition of translation	IDA	23820254
GO:2000635	Process	Negative regulation of primary miRNA processing	IMP	31507089
GO:2000637	Process	Positive regulation of gene silencing by miRNA	IDA	23820254

Other IDs

• MIM: 102582
• HGNC: 11364
• e!Ensembl: ENSG00000168610

Protein

• UniProt ID: P40763
• Protein name: Signal transducer and activator of transcription 3 (Acute-phase response factor)
• Protein function: Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors (PubMed:10688651, PubMed:12359225, PubMed:12873986, PubMed:15194700, PubMed:17344214, PubMed:18242580, PubMed:23084476). Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene (PubMed:17344214). May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed:12873986). Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes (PubMed:12359225). Activated by IL31 through IL31RA (PubMed:15194700). Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity (PubMed:28065600). Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1 (PubMed:17344214). Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation (By similarity). May play an apoptotic role by transctivating BIRC5 expression under LEP activation (PubMed:18242580). Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity (PubMed:23084476). Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion (By similarity).
• PDB: 5AX3, 5U5S, 6NJS, 6NUQ, 6QHD, 6TLC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02865	STAT_int	2 → 120	STAT protein, protein interaction domain	Domain
  PF01017	STAT_alpha	141 → 313	STAT protein, all-alpha domain	Family
  PF02864	STAT_bind	325 → 464	STAT protein, DNA binding domain	Domain
  PF00017	SH2	584 → 674	SH2 domain	Domain

• Sequence:

  MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
  LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
  TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
  SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
  ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
  HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
  QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
  GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
  NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
  GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
  KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
  DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
  TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM

• Sequence length: 770