SSX2IP (SSX family member 2 interacting protein)

Gene

• Entrez ID: 117178
• Gene name: SSX family member 2 interacting protein
• Gene symbol: SSX2IP
• Synonyms: ADIP, hMsd1
• Chromosome: 1
• Chromosome location: 1p22.3
• Summary: This gene encodes a protein that binds the cancer-testis antigen Synovial Sarcoma X breakpoint 2 protein. The encoded protein may regulate the activity of Synovial Sarcoma X breakpoint 2 protein in malignant cells. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Oct 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016383	hsa-miR-193b-3p	Microarray	20304954
MIRT020713	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT042758	hsa-miR-339-5p	CLASH	23622248
MIRT049125	hsa-miR-92a-3p	CLASH	23622248
MIRT053144	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR	23776679
MIRT053145	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR	23776679
MIRT053532	hsa-miR-338-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23826132
MIRT148608	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT346489	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT346490	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT439534	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439535	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT718023	hsa-miR-6864-3p	HITS-CLIP	19536157
MIRT718024	hsa-miR-3672	HITS-CLIP	19536157
MIRT718025	hsa-miR-5189-3p	HITS-CLIP	19536157
MIRT718026	hsa-miR-4524a-3p	HITS-CLIP	19536157
MIRT726438	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT726439	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT726440	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT726441	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT726442	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726443	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT726444	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726445	hsa-miR-17-5p	HITS-CLIP	22473208

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12007189, 21516116, 21988832, 22458338, 24397932, 25416956, 25910212, 26545777, 26638075, 26675238, 26871637, 31515488, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0007098	Process	Centrosome cycle	IMP	23816619
GO:0007155	Process	Cell adhesion	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0032991	Component	Protein-containing complex	IDA
GO:0034451	Component	Centriolar satellite	IDA	23816619, 24356449
GO:0035020	Process	Regulation of Rac protein signal transduction	IEA
GO:0035735	Process	Intraciliary transport involved in cilium assembly	IMP	24356449
GO:0036064	Component	Ciliary basal body	IDA	24356449
GO:0060271	Process	Cilium assembly	IMP	24356449
GO:2000145	Process	Regulation of cell motility	IEA

Other IDs

• MIM: 608690
• HGNC: 16509
• e!Ensembl: ENSG00000117155

Protein

• UniProt ID: Q9Y2D8
• Protein name: Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein)
• Protein function: Belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). May connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin (By similarity). Involved in cell movement: localizes at the leading edge of moving cells in response to PDGF and is required for the formation of the leading edge and the promotion of cell movement, possibly via activation of Rac signaling (By similarity). Acts as a centrosome maturation factor, probably by maintaining the integrity of the pericentriolar material and proper microtubule nucleation at mitotic spindle poles. The function seems to implicate at least in part WRAP73; the SSX2IP:WRAP73 complex is proposed to act as regulator of spindle anchoring at the mitotic centrosome (PubMed:23816619, PubMed:26545777). Involved in ciliogenesis (PubMed:24356449). It is required for targeted recruitment of the BBSome, CEP290, RAB8, and SSTR3 to the cilia (PubMed:24356449).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11559	ADIP	63 → 214	Afadin- and alpha -actinin-Binding	Coiled-coil

• Sequence:

  MGDWMTVTDPGLSSESKTISQYTSETKMSPSSLYSQQVLCSSIPLSKNVHSFFSAFCTED
  NIEQSISYLDQELTTFGFPSLYEESKGKETKRELNIVAVLNCMNELLVLQRKNLLAQENV
  ETQNLKLGSDMDHLQSCYSKLKEQLETSRREMIGLQERDRQLQCKNRNLHQLLKNEKDEV
  QKLQNIIASRATQYNHDMKRKEREYNKLKERLHQLVMNKKDKKIAMDILNYVGRADGKRG
  SWRTGKTEARNEDEMYKILLNDYEYRQKQILMENAELKKVLQQMKKEMISLLSPQKKKPR
  ERVDDSTGTVISDVEEDAGELSRESMWDLSCETVREQLTNSIRKQWRILKSHVEKLDNQV
  SKVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATAYDDDTTSLL
  RDCYLLEEKERLKEEWSLFKEQKKNFERERRSFTEAAIRLGLERKAFEEERASWLKQQFL
  NMTTFDHQNSENVKLFSAFSGSSDWDNLIVHSRQPQKKPHSVSNGSPVCMSKLTKSLPAS
  PSTSDFCQTRSCISEHSSINVLNITAEEIKPNQVGGECTNQKWSVASRPGSQEGCYSGCS
  LSYTNSHVEKDDLP

• Sequence length: 614