GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

SRC (SRC proto-oncogene, non-receptor tyrosine kinase)

Gene

6714

SRC proto-oncogene, non-receptor tyrosine kinase

SRC

ASV, SRC1, THC6, c-SRC, p60-Src

20q11.23

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibi

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121913314	C>T	Likely-pathogenic, pathogenic	Stop gained, coding sequence variant
rs879255268	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant

Show/Hide all(165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007051	hsa-miR-23b-3p	Luciferase reporter assay	23074286
MIRT007357	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT007357	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT024971	hsa-miR-205-5p	Reporter assay	21330408
MIRT053284	hsa-miR-203a-3p	Immunoprecipitaion, qRT-PCR, Western blot	23462723
MIRT053284	hsa-miR-203a-3p	Microarray	23807165
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23790975
MIRT053284	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23790975
MIRT053750	hsa-miR-31-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22948084
MIRT053592	hsa-miR-34a-5p	Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR	23533633
MIRT054922	hsa-miR-33b-5p	Luciferase reporter assay, qRT-PCR	23716591
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26676753
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26676753
MIRT053592	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26676753
MIRT755589	hsa-miR-5703	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence	34976193
MIRT1387602	hsa-miR-1207-5p	CLIP-seq
MIRT1387603	hsa-miR-1208	CLIP-seq
MIRT1387604	hsa-miR-1225-5p	CLIP-seq
MIRT1387605	hsa-miR-1253	CLIP-seq
MIRT1387606	hsa-miR-1283	CLIP-seq
MIRT1387607	hsa-miR-141	CLIP-seq
MIRT1387608	hsa-miR-1976	CLIP-seq
MIRT1387609	hsa-miR-200a	CLIP-seq
MIRT1387610	hsa-miR-2355-5p	CLIP-seq
MIRT1387611	hsa-miR-2964a-5p	CLIP-seq
MIRT1387612	hsa-miR-3189-3p	CLIP-seq
MIRT1387613	hsa-miR-3667-3p	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT1387615	hsa-miR-3945	CLIP-seq
MIRT1387616	hsa-miR-4253	CLIP-seq
MIRT1387617	hsa-miR-4286	CLIP-seq
MIRT1387618	hsa-miR-4434	CLIP-seq
MIRT1387619	hsa-miR-4512	CLIP-seq
MIRT1387620	hsa-miR-4516	CLIP-seq
MIRT1387621	hsa-miR-4736	CLIP-seq
MIRT1387622	hsa-miR-4757-5p	CLIP-seq
MIRT1387623	hsa-miR-4763-3p	CLIP-seq
MIRT1387624	hsa-miR-555	CLIP-seq
MIRT1387625	hsa-miR-635	CLIP-seq
MIRT1387626	hsa-miR-1	CLIP-seq
MIRT1387627	hsa-miR-1204	CLIP-seq
MIRT1387603	hsa-miR-1208	CLIP-seq
MIRT1387628	hsa-miR-1225-3p	CLIP-seq
MIRT1387604	hsa-miR-1225-5p	CLIP-seq
MIRT1387629	hsa-miR-1233	CLIP-seq
MIRT1387605	hsa-miR-1253	CLIP-seq
MIRT1387606	hsa-miR-1283	CLIP-seq
MIRT1387630	hsa-miR-1299	CLIP-seq
MIRT1387607	hsa-miR-141	CLIP-seq
MIRT1387631	hsa-miR-184	CLIP-seq
MIRT1387609	hsa-miR-200a	CLIP-seq
MIRT1387632	hsa-miR-206	CLIP-seq
MIRT1387633	hsa-miR-2110	CLIP-seq
MIRT1387634	hsa-miR-214	CLIP-seq
MIRT1387635	hsa-miR-3136-5p	CLIP-seq
MIRT1387636	hsa-miR-3173-3p	CLIP-seq
MIRT1387612	hsa-miR-3189-3p	CLIP-seq
MIRT1387637	hsa-miR-338-5p	CLIP-seq
MIRT1387638	hsa-miR-342-5p	CLIP-seq
MIRT1387639	hsa-miR-346	CLIP-seq
MIRT1387640	hsa-miR-3605-3p	CLIP-seq
MIRT1387641	hsa-miR-3619-5p	CLIP-seq
MIRT1387642	hsa-miR-3673	CLIP-seq
MIRT1387643	hsa-miR-3690	CLIP-seq
MIRT1387644	hsa-miR-378	CLIP-seq
MIRT1387645	hsa-miR-378b	CLIP-seq
MIRT1387646	hsa-miR-378c	CLIP-seq
MIRT1387647	hsa-miR-378d	CLIP-seq
MIRT1387648	hsa-miR-378e	CLIP-seq
MIRT1387649	hsa-miR-378f	CLIP-seq
MIRT1387650	hsa-miR-378h	CLIP-seq
MIRT1387651	hsa-miR-378i	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT1387615	hsa-miR-3945	CLIP-seq
MIRT1387652	hsa-miR-3973	CLIP-seq
MIRT1387653	hsa-miR-422a	CLIP-seq
MIRT1387616	hsa-miR-4253	CLIP-seq
MIRT1387654	hsa-miR-4254	CLIP-seq
MIRT1387655	hsa-miR-4271	CLIP-seq
MIRT1387656	hsa-miR-4276	CLIP-seq
MIRT1387657	hsa-miR-4288	CLIP-seq
MIRT1387658	hsa-miR-4419a	CLIP-seq
MIRT1387618	hsa-miR-4434	CLIP-seq
MIRT1387659	hsa-miR-4439	CLIP-seq
MIRT1387660	hsa-miR-4459	CLIP-seq
MIRT1387661	hsa-miR-4510	CLIP-seq
MIRT1387619	hsa-miR-4512	CLIP-seq
MIRT1387662	hsa-miR-4514	CLIP-seq
MIRT1387620	hsa-miR-4516	CLIP-seq
MIRT1387663	hsa-miR-4533	CLIP-seq
MIRT1387664	hsa-miR-4651	CLIP-seq
MIRT1387665	hsa-miR-4664-5p	CLIP-seq
MIRT1387666	hsa-miR-4685-5p	CLIP-seq
MIRT1387667	hsa-miR-4690-5p	CLIP-seq
MIRT1387668	hsa-miR-4692	CLIP-seq
MIRT1387669	hsa-miR-4695-5p	CLIP-seq
MIRT1387670	hsa-miR-4699-3p	CLIP-seq
MIRT1387671	hsa-miR-4725-3p	CLIP-seq
MIRT1387672	hsa-miR-4731-5p	CLIP-seq
MIRT1387673	hsa-miR-4747-5p	CLIP-seq
MIRT1387674	hsa-miR-4751	CLIP-seq
MIRT1387675	hsa-miR-4765	CLIP-seq
MIRT1387676	hsa-miR-4779	CLIP-seq
MIRT1387677	hsa-miR-4782-5p	CLIP-seq
MIRT1387678	hsa-miR-4795-5p	CLIP-seq
MIRT1387679	hsa-miR-4804-5p	CLIP-seq
MIRT1387680	hsa-miR-491-5p	CLIP-seq
MIRT1387681	hsa-miR-516b	CLIP-seq
MIRT1387682	hsa-miR-518a-5p	CLIP-seq
MIRT1387683	hsa-miR-527	CLIP-seq
MIRT1387684	hsa-miR-548k	CLIP-seq
MIRT1387685	hsa-miR-548l	CLIP-seq
MIRT1387624	hsa-miR-555	CLIP-seq
MIRT1387686	hsa-miR-608	CLIP-seq
MIRT1387687	hsa-miR-613	CLIP-seq
MIRT1387688	hsa-miR-632	CLIP-seq
MIRT1387625	hsa-miR-635	CLIP-seq
MIRT1387689	hsa-miR-654-3p	CLIP-seq
MIRT1387690	hsa-miR-665	CLIP-seq
MIRT1387691	hsa-miR-720	CLIP-seq
MIRT1387692	hsa-miR-759	CLIP-seq
MIRT1387693	hsa-miR-760	CLIP-seq
MIRT1387694	hsa-miR-761	CLIP-seq
MIRT1387695	hsa-miR-940	CLIP-seq
MIRT1387696	hsa-miR-943	CLIP-seq
MIRT1387602	hsa-miR-1207-5p	CLIP-seq
MIRT1387623	hsa-miR-4763-3p	CLIP-seq
MIRT1387602	hsa-miR-1207-5p	CLIP-seq
MIRT2116133	hsa-miR-1254	CLIP-seq
MIRT2116134	hsa-miR-1281	CLIP-seq
MIRT2116135	hsa-miR-2682	CLIP-seq
MIRT2116136	hsa-miR-3064-3p	CLIP-seq
MIRT2116137	hsa-miR-3116	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT2116138	hsa-miR-449c	CLIP-seq
MIRT2116139	hsa-miR-4707-3p	CLIP-seq
MIRT2116140	hsa-miR-4714-5p	CLIP-seq
MIRT1387623	hsa-miR-4763-3p	CLIP-seq
MIRT2116141	hsa-miR-486-3p	CLIP-seq
MIRT1387695	hsa-miR-940	CLIP-seq
MIRT2338550	hsa-miR-153	CLIP-seq
MIRT2338551	hsa-miR-1909	CLIP-seq
MIRT1387634	hsa-miR-214	CLIP-seq
MIRT1387641	hsa-miR-3619-5p	CLIP-seq
MIRT1387655	hsa-miR-4271	CLIP-seq
MIRT1387663	hsa-miR-4533	CLIP-seq
MIRT2338552	hsa-miR-4643	CLIP-seq
MIRT1387671	hsa-miR-4725-3p	CLIP-seq
MIRT1387673	hsa-miR-4747-5p	CLIP-seq
MIRT2338553	hsa-miR-4789-3p	CLIP-seq
MIRT1387694	hsa-miR-761	CLIP-seq
MIRT2395146	hsa-miR-10a	CLIP-seq
MIRT2395147	hsa-miR-10b	CLIP-seq
MIRT1387610	hsa-miR-2355-5p	CLIP-seq
MIRT1387614	hsa-miR-3918	CLIP-seq
MIRT2395148	hsa-miR-4267	CLIP-seq
MIRT1387619	hsa-miR-4512	CLIP-seq
MIRT2395149	hsa-miR-4690-3p	CLIP-seq
MIRT2632121	hsa-miR-1236	CLIP-seq
MIRT1387608	hsa-miR-1976	CLIP-seq
MIRT2632122	hsa-miR-3180-5p	CLIP-seq
MIRT2632123	hsa-miR-4279	CLIP-seq
MIRT2632124	hsa-miR-4326	CLIP-seq
MIRT2632125	hsa-miR-520a-5p	CLIP-seq
MIRT2632126	hsa-miR-525-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SP1	Unknown	19112177
TAF1	Unknown	14993269

Show/Hide all(186)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001545	Process	Primary ovarian follicle growth	IEA
GO:0002102	Component	Podosome	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IDA	18616680
GO:0004672	Function	Protein kinase activity	TAS
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 9799234, 11448999, 12923167, 15735019, 18697750, 20100835
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IDA	16441665, 19059439, 19307596
GO:0004713	Function	Protein tyrosine kinase activity	IMP	20624904, 25425738
GO:0004713	Function	Protein tyrosine kinase activity	NAS	28386764
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	20018849
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	19267251
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005102	Function	Signaling receptor binding	IPI	19332538
GO:0005158	Function	Insulin receptor binding	IEA
GO:0005178	Function	Integrin binding	IPI	19141530
GO:0005178	Function	Integrin binding	TAS	19267251
GO:0005515	Function	Protein binding	IPI	7478590, 7537265, 8070403, 8681387, 8849729, 9148935, 9162084, 9600099, 9763511, 10521452, 10542110, 10698938, 10801826, 11007774, 11149930, 11741929, 11923305, 11940572, 12509223, 12857726, 14963108, 15143158, 15546919, 15735685, 15749833, 15866871, 16115959, 16169070, 16273093, 162
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16441665
GO:0005739	Component	Mitochondrion	IDA	19767770
GO:0005743	Component	Mitochondrial inner membrane	IDA	12615910
GO:0005764	Component	Lysosome	IDA	20605918
GO:0005770	Component	Late endosome	IDA	20605918
GO:0005829	Component	Cytosol	IDA	19767770
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IDA	20605918
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	17848177
GO:0005925	Component	Focal adhesion	ISS
GO:0007049	Process	Cell cycle	IEA
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9020193, 10734107
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007172	Process	Signal complex assembly	TAS	9924018
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA	21873635
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	24036928
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24036928
GO:0007411	Process	Axon guidance	TAS
GO:0008022	Function	Protein C-terminus binding	IPI	25425738
GO:0008283	Process	Cell population proliferation	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009615	Process	Response to virus	IEA
GO:0010447	Process	Response to acidic pH	IEA
GO:0010632	Process	Regulation of epithelial cell migration	IMP	21724833
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	18054784
GO:0010907	Process	Positive regulation of glucose metabolic process	IEA
GO:0010954	Process	Positive regulation of protein processing	IEA
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016032	Process	Viral process	IEA
GO:0016236	Process	Macroautophagy	TAS
GO:0016301	Function	Kinase activity	TAS
GO:0018105	Process	Peptidyl-serine phosphorylation	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	12051764, 22732588
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	20624904, 25425738
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	NAS	20018849
GO:0019899	Function	Enzyme binding	IPI	21724833
GO:0019900	Function	Kinase binding	IPI	19059439
GO:0020037	Function	Heme binding	IDA	21036157
GO:0022407	Process	Regulation of cell-cell adhesion	IMP	21724833
GO:0030054	Component	Cell junction	IDA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030331	Function	Estrogen receptor binding	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031295	Process	T cell costimulation	TAS
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	19767770
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031648	Process	Protein destabilization	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031954	Process	Positive regulation of protein autophosphorylation	IEA
GO:0032148	Process	Activation of protein kinase B activity	IEA
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	21531765
GO:0032587	Component	Ruffle membrane	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0033146	Process	Regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0033625	Process	Positive regulation of integrin activation	TAS	19267251
GO:0034332	Process	Adherens junction organization	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0035306	Process	Positive regulation of dephosphorylation	IDA	23159740
GO:0035556	Process	Intracellular signal transduction	IDA	15248232
GO:0035635	Process	Entry of bacterium into host cell	TAS
GO:0036035	Process	Osteoclast development	IBA	21873635
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042169	Function	SH2 domain binding	IPI	8070403
GO:0042476	Process	Odontogenesis	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19767770
GO:0043114	Process	Regulation of vascular permeability	TAS	19267251
GO:0043149	Process	Stress fiber assembly	IMP	24036928
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	19767770
GO:0043393	Process	Regulation of protein binding	IEA
GO:0043406	Process	Positive regulation of MAP kinase activity	IEA
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0044325	Function	Ion channel binding	IPI	8953041, 12538589
GO:0045056	Process	Transcytosis	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	ISS
GO:0045124	Process	Regulation of bone resorption	TAS	19267251
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045453	Process	Bone resorption	IBA	21873635
GO:0045453	Process	Bone resorption	ISS
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	IDA	25731159
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	16441665
GO:0046875	Function	Ephrin receptor binding	IPI	12925710
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048041	Process	Focal adhesion assembly	IMP	21411625
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19307596
GO:0048477	Process	Oogenesis	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IC	18054784
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IMP	26598555, 26706435
GO:0050847	Process	Progesterone receptor signaling pathway	IBA	21873635
GO:0050847	Process	Progesterone receptor signaling pathway	ISS
GO:0050900	Process	Leukocyte migration	TAS
GO:0051057	Process	Positive regulation of small GTPase mediated signal transduction	IMP	18541665
GO:0051117	Function	ATPase binding	ISS
GO:0051219	Function	Phosphoprotein binding	IPI	16441665
GO:0051222	Process	Positive regulation of protein transport	IEA
GO:0051385	Process	Response to mineralocorticoid	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	ISS
GO:0051897	Process	Positive regulation of protein kinase B signaling	IMP	19767770
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0051902	Process	Negative regulation of mitochondrial depolarization	IMP	19767770
GO:0051974	Process	Negative regulation of telomerase activity	IMP	21531765
GO:0060065	Process	Uterus development	IEA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060491	Process	Regulation of cell projection assembly	IEA
GO:0060576	Process	Intestinal epithelial cell development	IDA	25731159
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	25731159
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070555	Process	Response to interleukin-1	IMP	19281832
GO:0070700	Function	BMP receptor binding	IPI	26598555
GO:0070851	Function	Growth factor receptor binding	IBA	21873635
GO:0070851	Function	Growth factor receptor binding	IPI	16479011
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071253	Function	Connexin binding	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	ISS
GO:0071393	Process	Cellular response to progesterone stimulus	ISS
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0071803	Process	Positive regulation of podosome assembly	IEA
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	19059439
GO:0086098	Process	Angiotensin-activated signaling pathway involved in heart process	ISS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0097110	Function	Scaffold protein binding	IPI	25006397
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098962	Process	Regulation of postsynaptic neurotransmitter receptor activity	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099091	Component	Postsynaptic specialization, intracellular component	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1903997	Process	Positive regulation of non-membrane spanning protein tyrosine kinase activity	NAS	20018849
GO:2000386	Process	Positive regulation of ovarian follicle development	IEA
GO:2000394	Process	Positive regulation of lamellipodium morphogenesis	IMP	18054784
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA
GO:2000588	Process	Positive regulation of platelet-derived growth factor receptor-beta signaling pathway	IEA
GO:2000641	Process	Regulation of early endosome to late endosome transport	IMP	21724833
GO:2000811	Process	Negative regulation of anoikis	IMP	22402981
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IBA	21873635
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	19767770
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IBA	21873635
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IMP	19767770
GO:2001286	Process	Regulation of caveolin-mediated endocytosis	IMP	21724833

MIM	HGNC	e!Ensembl
190090	11283	ENSG00000197122

Protein

UniProt ID

P12931

Protein name

Proto-oncogene tyrosine-protein kinase Src (EC 2.7.10.2) (Proto-oncogene c-Src) (pp60c-src) (p60-Src)

Protein function

Non-receptor protein tyrosine kinase which is activated following engagement of many different classes of cellular receptors including immune response receptors, integrins and other adhesion receptors, receptor protein tyrosine kinases, G protei

PDB

1A07 , 1A08 , 1A09 , 1A1A , 1A1B , 1A1C , 1A1E , 1FMK , 1HCS , 1HCT , 1KSW , 1O41 , 1O42 , 1O43 , 1O44 , 1O45 , 1O46 , 1O47 , 1O48 , 1O49 , 1O4A , 1O4B , 1O4C , 1O4D , 1O4E , 1O4F , 1O4G , 1O4H , 1O4I , 1O4J , 1O4K , 1O4L , 1O4M , 1O4N , 1O4O , 1O4P , 1O4Q , 1O4R , 1SHD , 1Y57 , 1YI6 , 1YOJ , 1YOL , 1YOM , 2BDF , 2BDJ , 2H8H , 2SRC , 3VRO , 3ZMP , 3ZMQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	90 → 137	SH3 domain	Domain
PF00017	SH2	151 → 233	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	270 → 519	Protein tyrosine and serine/threonine kinase	Domain

Sequence

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Sequence length

536

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412