SPI1 (Spi-1 proto-oncogene)

Gene

• Entrez ID: 6688
• Gene name: Spi-1 proto-oncogene
• Gene symbol: SPI1
• Synonyms: AGM10, OF, PU.1, SFPI1, SPI-1, SPI-A
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regul

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004282	hsa-miR-155-5p	Luciferase reporter assay	19386588
MIRT004282	hsa-miR-155-5p	Luciferase reporter assay	19386588
MIRT004629	hsa-miR-342-3p	Review	20026422
MIRT004827	hsa-miR-569	Luciferase reporter assay	21360505
MIRT005724	hsa-miR-34a-5p	Luciferase reporter assay	20598588
MIRT005928	hsa-miR-424-5p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20972335
MIRT004282	hsa-miR-155-5p	Reporter assay	20680360
MIRT004282	hsa-miR-155-5p	Proteomics	18668040
MIRT004282	hsa-miR-155-5p	Proteomics	18668040
MIRT021410	hsa-miR-9-5p	Microarray	17612493
MIRT005724	hsa-miR-34a-5p	Reporter assay	20598588
MIRT038360	hsa-miR-296-3p	CLASH	23622248
MIRT004282	hsa-miR-155-5p	Luciferase reporter assay, Western blot	25288398
MIRT004282	hsa-miR-155-5p	Luciferase reporter assay, Western blot	25288398
MIRT625720	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT625719	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT625718	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT625717	hsa-miR-6090	HITS-CLIP	23824327
MIRT625716	hsa-miR-3657	HITS-CLIP	23824327
MIRT625715	hsa-miR-4669	HITS-CLIP	23824327
MIRT625714	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625713	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT625720	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT625719	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT625718	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT625717	hsa-miR-6090	HITS-CLIP	23824327
MIRT625716	hsa-miR-3657	HITS-CLIP	23824327
MIRT625715	hsa-miR-4669	HITS-CLIP	23824327
MIRT625714	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625713	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT625721	hsa-miR-5587-3p	HITS-CLIP	23824327
MIRT625720	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT625719	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT625718	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT625717	hsa-miR-6090	HITS-CLIP	23824327
MIRT625716	hsa-miR-3657	HITS-CLIP	23824327
MIRT625715	hsa-miR-4669	HITS-CLIP	23824327
MIRT625714	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625713	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT004282	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT004282	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT004282	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Immunoprecipitaion, Western blot	25092144
MIRT004282	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Immunoprecipitaion, Western blot	25092144
MIRT735048	hsa-miR-155-3p	Microarray	32990751
MIRT735969	hsa-miR-27a-5p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	34201504
MIRT625720	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT625719	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT625718	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT625717	hsa-miR-6090	HITS-CLIP	23824327
MIRT625716	hsa-miR-3657	HITS-CLIP	23824327
MIRT625715	hsa-miR-4669	HITS-CLIP	23824327
MIRT625714	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625713	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT625720	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT625719	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT625718	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT625717	hsa-miR-6090	HITS-CLIP	23824327
MIRT625716	hsa-miR-3657	HITS-CLIP	23824327
MIRT625715	hsa-miR-4669	HITS-CLIP	23824327
MIRT625714	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625713	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT625721	hsa-miR-5587-3p	HITS-CLIP	23824327
MIRT625720	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT625719	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT625718	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT625717	hsa-miR-6090	HITS-CLIP	23824327
MIRT625716	hsa-miR-3657	HITS-CLIP	23824327
MIRT625715	hsa-miR-4669	HITS-CLIP	23824327
MIRT625714	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625713	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT1554092	hsa-miR-3158-3p	CLIP-seq
MIRT1554093	hsa-miR-4649-5p	CLIP-seq
MIRT1554094	hsa-miR-4721	CLIP-seq
MIRT2114904	hsa-miR-129-5p	CLIP-seq
MIRT2114905	hsa-miR-3122	CLIP-seq
MIRT1554092	hsa-miR-3158-3p	CLIP-seq
MIRT2114906	hsa-miR-3689a-3p	CLIP-seq
MIRT2114907	hsa-miR-3689c	CLIP-seq
MIRT2114908	hsa-miR-3913-5p	CLIP-seq
MIRT1554093	hsa-miR-4649-5p	CLIP-seq
MIRT1554094	hsa-miR-4721	CLIP-seq
MIRT2114909	hsa-miR-4728-5p	CLIP-seq
MIRT2114910	hsa-miR-765	CLIP-seq
MIRT2337617	hsa-miR-1207-3p	CLIP-seq
MIRT2114904	hsa-miR-129-5p	CLIP-seq
MIRT2114905	hsa-miR-3122	CLIP-seq
MIRT1554092	hsa-miR-3158-3p	CLIP-seq
MIRT2114906	hsa-miR-3689a-3p	CLIP-seq
MIRT2114907	hsa-miR-3689c	CLIP-seq
MIRT2114908	hsa-miR-3913-5p	CLIP-seq
MIRT1554093	hsa-miR-4649-5p	CLIP-seq
MIRT1554094	hsa-miR-4721	CLIP-seq
MIRT2114909	hsa-miR-4728-5p	CLIP-seq
MIRT2337618	hsa-miR-615-5p	CLIP-seq
MIRT2114910	hsa-miR-765	CLIP-seq
MIRT2114904	hsa-miR-129-5p	CLIP-seq
MIRT2114905	hsa-miR-3122	CLIP-seq
MIRT1554092	hsa-miR-3158-3p	CLIP-seq
MIRT2114906	hsa-miR-3689a-3p	CLIP-seq
MIRT2114907	hsa-miR-3689c	CLIP-seq
MIRT2114908	hsa-miR-3913-5p	CLIP-seq
MIRT1554093	hsa-miR-4649-5p	CLIP-seq
MIRT1554094	hsa-miR-4721	CLIP-seq
MIRT2114909	hsa-miR-4728-5p	CLIP-seq
MIRT2114910	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	24429361
CEBPE	Repression	12202480
FOS	Repression	9988737
GATA1	Repression	10753833
GATA2	Repression	19620289
HOXC13	Repression	18076876
JUN	Activation	9988737
POU2F2	Unknown	12592383
RUNX1	Activation	12576332;18316480
SATB1	Activation	17694175

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	15304486
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20139074
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001085	Function	RNA polymerase II transcription factor binding	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12833137
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	10207087, 18250304, 18692240, 20159610, 21575865, 26019275
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	20972335
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IDA	24429361
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008134	Function	Transcription factor binding	IPI	24429361
GO:0010629	Process	Negative regulation of gene expression	IMP	29290617
GO:0030098	Process	Lymphocyte differentiation	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030851	Process	Granulocyte differentiation	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043966	Process	Histone H3 acetylation	IMP	20139074
GO:0044027	Process	Hypermethylation of CpG island	IDA	20139074
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	IEA
GO:0045646	Process	Regulation of erythrocyte differentiation	IMP	12833137
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IDA	20139074
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	20139074
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12833137
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	24429361
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0051525	Function	NFAT protein binding	ISS
GO:0060033	Process	Anatomical structure regression	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	24429361
GO:0071361	Process	Cellular response to ethanol	IEA
GO:0090241	Process	Negative regulation of histone H4 acetylation	IMP	20139074
GO:0090402	Process	Oncogene-induced cell senescence	ISS
GO:1900745	Process	Positive regulation of p38MAPK cascade	ISS
GO:1902262	Process	Apoptotic process involved in blood vessel morphogenesis	IEA
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	20972335
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	ISS

Other IDs

• MIM: 165170
• HGNC: 11241
• e!Ensembl: ENSG00000066336

Protein

• UniProt ID: P17947
• Protein name: Transcription factor PU.1 (31 kDa-transforming protein)
• Protein function: Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control g
• PDB: 8E3K, 8E3R, 8E4H, 8E5Y, 8EBH, 8EE9, 8EJ6, 8EJ8, 8EK3, 8EK8, 8EKJ, 8EKU, 8EKV, 8EKZ, 8EM9, 8EMD, 8ENG, 8EO1, 8EO4, 8EQG, 8EQK, 8EQL, 8T9U, 8UFF, 8UFK, 8UFZ, 8UHK, 8V9N, 8VDH, 8VDI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00178	Ets	171 → 253	Ets-domain	Domain

• Sequence:

  MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
  EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ
  YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL
  RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
  VKKVKKKLTYQFSGEVLGRGGLAERRHPPH

• Sequence length: 270