SNAI2 (snail family transcriptional repressor 2)

Gene

• Entrez ID: 6591
• Gene name: Snail family transcriptional repressor 2
• Gene symbol: SNAI2
• Synonyms: SLUG, SLUGH, SLUGH1, SNAIL2, WS2D
• Chromosome: 8
• Chromosome location: 8q11.21
• Summary: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002716	hsa-miR-124-3p	Microarray	15685193
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	Microarray	18668037
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT007214	hsa-miR-1-3p	Flow, Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23142026
MIRT007214	hsa-miR-1-3p	Immunofluorescence, Immunohistochemistry, qRT-PCR, Western blot	24760686
MIRT007226	hsa-miR-182-5p	Luciferase reporter assay	23354685
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	23354685
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26194864
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	25871397
MIRT007227	hsa-miR-203a-3p	qRT-PCR, Western blot	28269747
MIRT007240	hsa-miR-545-3p	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23435373
MIRT019445	hsa-miR-148b-3p	Microarray	17612493
MIRT021454	hsa-miR-9-5p	Microarray	17612493
MIRT021687	hsa-miR-138-5p	Western blot;qRT-PCR	21770894
MIRT025178	hsa-miR-181a-5p	Microarray	17612493
MIRT054184	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	23717581
MIRT054655	hsa-miR-183-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT054656	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT439577	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT735545	hsa-miR-497-3p	Luciferase reporter assay, qRT-PCR, Western blot	26700673

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Repression	15955695
ESRRA	Repression	15955695
EZH2	Repression	23836662
HDAC1	Repression	18588516
HDAC2	Repression	23836662
LEF1	Unknown	20128911
MTA1	Activation	18719363
NCOR1	Repression	18588516
PER2	Repression	23836662
POU2F1	Activation	23836662
POU2F1	Repression	23836662
RUNX2	Activation	22641097
SUZ12	Repression	23836662
TCF7	Unknown	20128911
TCF7L2	Unknown	20128911
WT1	Unknown	17430890

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10866665, 11912130, 15737616, 16707493
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17984306, 18663143
GO:0000785	Component	Chromatin	IDA	16707493, 19756381
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11912130, 15737616, 16707493
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	10866665, 11912130, 15737616, 16707493, 18663143
GO:0001649	Process	Osteoblast differentiation	IEP	20128911
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	9182671, 17984306
GO:0003180	Process	Aortic valve morphogenesis	TAS	20951801
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	TAS	20951801
GO:0003273	Process	Cell migration involved in endocardial cushion formation	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IDA	10866665, 25893292
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0007219	Process	Notch signaling pathway	IMP	18663143
GO:0007605	Process	Sensory perception of sound	IMP	12444107
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IDA	16707493
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IDA	18485278, 19502595
GO:0014032	Process	Neural crest cell development	IMP	12444107
GO:0030335	Process	Positive regulation of cell migration	IMP	15314165
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IMP	19756381
GO:0032642	Process	Regulation of chemokine production	IMP	21182836
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	IDA	16707493
GO:0035921	Process	Desmosome disassembly	IMP	9182671
GO:0043473	Process	Pigmentation	IMP	12444107
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IMP	15314165
GO:0043565	Function	Sequence-specific DNA binding	IDA	10518215, 10866665
GO:0045667	Process	Regulation of osteoblast differentiation	IMP	19756381, 21182836
GO:0046872	Function	Metal ion binding	IEA
GO:0060429	Process	Epithelium development	ISS	18716062
GO:0061314	Process	Notch signaling involved in heart development	TAS	20951801
GO:0070563	Process	Negative regulation of vitamin D receptor signaling pathway	IDA	19502595
GO:0070888	Function	E-box binding	IDA	11912130
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	18716062
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	19502595
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	19756381
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15314165
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	15314165
GO:2000811	Process	Negative regulation of anoikis	IMP	17984306
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISS	10518215

Other IDs

• MIM: 602150
• HGNC: 11094
• e!Ensembl: ENSG00000019549

Protein

• UniProt ID: O43623
• Protein name: Zinc finger protein SNAI2 (Neural crest transcription factor Slug) (Protein snail homolog 2)
• Protein function: Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	128 → 150	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	159 → 181	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	185 → 207	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	213 → 235	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	241 → 262	Zinc finger, C2H2 type	Domain

• Sequence:

  MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
  TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
  HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
  HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
  YQCKNCSKTFSRMSLLHKHEESGCCVAH

• Sequence length: 268