GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

SMURF2 (SMAD specific E3 ubiquitin protein ligase 2)

Gene

64750

SMAD specific E3 ubiquitin protein ligase 2

SMURF2

17q23.3-q24.1

Show/Hide all(194)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023400	hsa-miR-122-5p	Microarray	17612493
MIRT031987	hsa-miR-16-5p	Microarray	21199864
MIRT653292	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT653291	hsa-miR-764	HITS-CLIP	23824327
MIRT653290	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT653289	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT653288	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT653287	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT653286	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT653285	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT653284	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT653283	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT653282	hsa-miR-4454	HITS-CLIP	23824327
MIRT653281	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT542376	hsa-miR-6872-3p	PAR-CLIP	21572407
MIRT542375	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT534142	hsa-miR-3667-5p	PAR-CLIP	22012620
MIRT534141	hsa-miR-4495	PAR-CLIP	22012620
MIRT534140	hsa-miR-665	PAR-CLIP	22012620
MIRT534139	hsa-miR-4635	PAR-CLIP	22012620
MIRT197869	hsa-miR-630	PAR-CLIP	22012620
MIRT534138	hsa-miR-526b-5p	PAR-CLIP	22012620
MIRT450665	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT450664	hsa-miR-382-5p	PAR-CLIP	22100165
MIRT450663	hsa-miR-93-3p	PAR-CLIP	22100165
MIRT450662	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT450661	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450660	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT733577	hsa-miR-497-5p	Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting	33193708
MIRT733577	hsa-miR-497-5p	Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting	33193708
MIRT736113	hsa-miR-503-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	33872218
MIRT653292	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT653291	hsa-miR-764	HITS-CLIP	23824327
MIRT653290	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT653289	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT653288	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT653287	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT653286	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT653285	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT653284	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT653283	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT653282	hsa-miR-4454	HITS-CLIP	23824327
MIRT653281	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT542376	hsa-miR-6872-3p	PAR-CLIP	21572407
MIRT542375	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT534142	hsa-miR-3667-5p	PAR-CLIP	22012620
MIRT534141	hsa-miR-4495	PAR-CLIP	22012620
MIRT534140	hsa-miR-665	PAR-CLIP	22012620
MIRT534139	hsa-miR-4635	PAR-CLIP	22012620
MIRT197869	hsa-miR-630	PAR-CLIP	22012620
MIRT534138	hsa-miR-526b-5p	PAR-CLIP	22012620
MIRT450665	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT450664	hsa-miR-382-5p	PAR-CLIP	22100165
MIRT450663	hsa-miR-93-3p	PAR-CLIP	22100165
MIRT450662	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT450661	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450660	hsa-miR-511-5p	PAR-CLIP	22100165
MIRT1374472	hsa-miR-1179	CLIP-seq
MIRT1374473	hsa-miR-15a	CLIP-seq
MIRT1374474	hsa-miR-15b	CLIP-seq
MIRT1374475	hsa-miR-16	CLIP-seq
MIRT1374476	hsa-miR-195	CLIP-seq
MIRT1374477	hsa-miR-299-5p	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT1374479	hsa-miR-3646	CLIP-seq
MIRT1374480	hsa-miR-3919	CLIP-seq
MIRT1374481	hsa-miR-424	CLIP-seq
MIRT1374482	hsa-miR-4310	CLIP-seq
MIRT1374483	hsa-miR-4464	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT1374485	hsa-miR-4524	CLIP-seq
MIRT1374486	hsa-miR-4698	CLIP-seq
MIRT1374487	hsa-miR-4719	CLIP-seq
MIRT1374488	hsa-miR-4723-5p	CLIP-seq
MIRT1374489	hsa-miR-4748	CLIP-seq
MIRT1374490	hsa-miR-4756-3p	CLIP-seq
MIRT1374491	hsa-miR-497	CLIP-seq
MIRT1374492	hsa-miR-502-5p	CLIP-seq
MIRT1374493	hsa-miR-503	CLIP-seq
MIRT1374494	hsa-miR-607	CLIP-seq
MIRT1374495	hsa-miR-646	CLIP-seq
MIRT1374496	hsa-miR-659	CLIP-seq
MIRT1374497	hsa-miR-9	CLIP-seq
MIRT1374473	hsa-miR-15a	CLIP-seq
MIRT1374474	hsa-miR-15b	CLIP-seq
MIRT1374475	hsa-miR-16	CLIP-seq
MIRT1374476	hsa-miR-195	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT1374481	hsa-miR-424	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT1374485	hsa-miR-4524	CLIP-seq
MIRT1553871	hsa-miR-4757-5p	CLIP-seq
MIRT1374491	hsa-miR-497	CLIP-seq
MIRT1374493	hsa-miR-503	CLIP-seq
MIRT1374495	hsa-miR-646	CLIP-seq
MIRT1553872	hsa-miR-663b	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT1557071	hsa-miR-3185	CLIP-seq
MIRT1374472	hsa-miR-1179	CLIP-seq
MIRT2111443	hsa-miR-1206	CLIP-seq
MIRT2111444	hsa-miR-1208	CLIP-seq
MIRT1374473	hsa-miR-15a	CLIP-seq
MIRT1374474	hsa-miR-15b	CLIP-seq
MIRT1374475	hsa-miR-16	CLIP-seq
MIRT1374476	hsa-miR-195	CLIP-seq
MIRT1374477	hsa-miR-299-5p	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT2111445	hsa-miR-330-3p	CLIP-seq
MIRT2111446	hsa-miR-34b	CLIP-seq
MIRT1374480	hsa-miR-3919	CLIP-seq
MIRT1374481	hsa-miR-424	CLIP-seq
MIRT1374482	hsa-miR-4310	CLIP-seq
MIRT2111447	hsa-miR-4422	CLIP-seq
MIRT2111448	hsa-miR-4470	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT2111449	hsa-miR-4496	CLIP-seq
MIRT1374485	hsa-miR-4524	CLIP-seq
MIRT1374490	hsa-miR-4756-3p	CLIP-seq
MIRT1553871	hsa-miR-4757-5p	CLIP-seq
MIRT2111450	hsa-miR-485-3p	CLIP-seq
MIRT1374491	hsa-miR-497	CLIP-seq
MIRT1374493	hsa-miR-503	CLIP-seq
MIRT1374495	hsa-miR-646	CLIP-seq
MIRT1374496	hsa-miR-659	CLIP-seq
MIRT1553872	hsa-miR-663b	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT1374497	hsa-miR-9	CLIP-seq
MIRT1374472	hsa-miR-1179	CLIP-seq
MIRT2111443	hsa-miR-1206	CLIP-seq
MIRT2111444	hsa-miR-1208	CLIP-seq
MIRT2334578	hsa-miR-1244	CLIP-seq
MIRT2334579	hsa-miR-1299	CLIP-seq
MIRT2334580	hsa-miR-200b	CLIP-seq
MIRT2334581	hsa-miR-200c	CLIP-seq
MIRT2334582	hsa-miR-223	CLIP-seq
MIRT2334583	hsa-miR-296-3p	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT2334584	hsa-miR-3173-3p	CLIP-seq
MIRT2111446	hsa-miR-34b	CLIP-seq
MIRT2334585	hsa-miR-382	CLIP-seq
MIRT2334586	hsa-miR-4280	CLIP-seq
MIRT2334587	hsa-miR-429	CLIP-seq
MIRT1374482	hsa-miR-4310	CLIP-seq
MIRT1374484	hsa-miR-4477a	CLIP-seq
MIRT2111449	hsa-miR-4496	CLIP-seq
MIRT2334588	hsa-miR-4695-5p	CLIP-seq
MIRT2334589	hsa-miR-4697-3p	CLIP-seq
MIRT2334590	hsa-miR-4704-3p	CLIP-seq
MIRT2334591	hsa-miR-4738-3p	CLIP-seq
MIRT2334592	hsa-miR-4766-5p	CLIP-seq
MIRT2111450	hsa-miR-485-3p	CLIP-seq
MIRT2334593	hsa-miR-485-5p	CLIP-seq
MIRT2334594	hsa-miR-488	CLIP-seq
MIRT2334595	hsa-miR-514	CLIP-seq
MIRT2334596	hsa-miR-514b-3p	CLIP-seq
MIRT2334597	hsa-miR-549	CLIP-seq
MIRT2334598	hsa-miR-568	CLIP-seq
MIRT2334599	hsa-miR-595	CLIP-seq
MIRT2334600	hsa-miR-618	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT2334601	hsa-miR-875-3p	CLIP-seq
MIRT2394895	hsa-miR-128	CLIP-seq
MIRT2394896	hsa-miR-2355-3p	CLIP-seq
MIRT2394897	hsa-miR-27a	CLIP-seq
MIRT2394898	hsa-miR-27b	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT1374479	hsa-miR-3646	CLIP-seq
MIRT2394899	hsa-miR-3662	CLIP-seq
MIRT2394900	hsa-miR-3679-3p	CLIP-seq
MIRT1374486	hsa-miR-4698	CLIP-seq
MIRT1374487	hsa-miR-4719	CLIP-seq
MIRT1553873	hsa-miR-676	CLIP-seq
MIRT2433338	hsa-miR-203	CLIP-seq
MIRT2334582	hsa-miR-223	CLIP-seq
MIRT1374478	hsa-miR-3121-3p	CLIP-seq
MIRT2334584	hsa-miR-3173-3p	CLIP-seq
MIRT2334588	hsa-miR-4695-5p	CLIP-seq
MIRT2334589	hsa-miR-4697-3p	CLIP-seq
MIRT2334591	hsa-miR-4738-3p	CLIP-seq
MIRT2334592	hsa-miR-4766-5p	CLIP-seq
MIRT2334593	hsa-miR-485-5p	CLIP-seq
MIRT2334594	hsa-miR-488	CLIP-seq
MIRT2628595	hsa-miR-1253	CLIP-seq
MIRT2628596	hsa-miR-3163	CLIP-seq
MIRT2628597	hsa-miR-3194-3p	CLIP-seq
MIRT2628598	hsa-miR-3921	CLIP-seq
MIRT2628599	hsa-miR-4251	CLIP-seq
MIRT2628600	hsa-miR-4329	CLIP-seq
MIRT2628601	hsa-miR-4653-5p	CLIP-seq
MIRT2628602	hsa-miR-4668-3p	CLIP-seq
MIRT2628603	hsa-miR-545	CLIP-seq
MIRT2628604	hsa-miR-548c-3p	CLIP-seq
MIRT2628605	hsa-miR-548p	CLIP-seq
MIRT2628606	hsa-miR-605	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000151	Component	Ubiquitin ligase complex	IDA	14755250
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	14755250
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005160	Function	Transforming growth factor beta receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	14755250, 15231748, 17719543, 18729074, 18985028, 20676133, 20937913, 21572392, 22045334, 22921829, 25438670, 28514442, 30696809, 32296183
GO:0005634	Component	Nucleus	NAS	11163210
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	14755250
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016607	Component	Nuclear speck	IDA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	NAS	11158580
GO:0030509	Process	BMP signaling pathway	TAS
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	19255252
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030514	Process	Negative regulation of BMP signaling pathway	IBA	21873635
GO:0030579	Process	Ubiquitin-dependent SMAD protein catabolic process	IBA	21873635
GO:0030579	Process	Ubiquitin-dependent SMAD protein catabolic process	IDA	19122240
GO:0042802	Function	Identical protein binding	IPI	15231748, 17719543
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0045121	Component	Membrane raft	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	NAS	11016919
GO:0046332	Function	SMAD binding	IPI	19122240
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901165	Process	Positive regulation of trophoblast cell migration	IDA	19255252

MIM	HGNC	e!Ensembl
605532	16809	ENSG00000108854

Protein

UniProt ID

Q9HAU4

Protein name

E3 ubiquitin-protein ligase SMURF2 (hSMURF2) (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase SMURF2) (SMAD ubiquitination regulatory factor 2) (SMAD-specific E3 ubiquitin-protein ligase 2)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:11016919). Interacts with SMAD7 to trigger SMAD7-medi

PDB

1ZVD , 2DJY , 2JQZ , 2KXQ , 2LTZ , 6FX4 , 7M3Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	12 → 114	C2 domain	Domain
PF00397	WW	159 → 188	WW domain	Domain
PF00397	WW	253 → 282	WW domain	Domain
PF00397	WW	299 → 328	WW domain	Domain
PF00632	HECT	443 → 748	HECT-domain (ubiquitin-transferase)	Domain

Sequence

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE

Sequence length

748

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412